Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mammaglobin-A (SCGB2A2)

Recombinant Human Mammaglobin-A (SCGB2A2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Mammaglobin-A (SCGB2A2) . Accession Number: Q13296; SCGB2A2. Expression Region: 1-93aa. Tag Info: N-terminal GST-tagged. Theoretical MW: 37.5kda. Target Synonyms: Mammaglobin-1; Secretoglobin family 2A member 2; MGB1; UGB2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Mammaglobin-A (SCGB2A2) is a purified Recombinant Protein.

Accession Number

Q13296; SCGB2A2

Expression Region

1-93aa

Host

E. coli

Target

Mammaglobin-A (SCGB2A2)

Conjugation

Unconjugated

Tag

N-Terminal GST-Tagged

Field of Research

Tags & Cell Markers

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

37.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Mammaglobin-1; Secretoglobin family 2A member 2; MGB1; UGB2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TipOne 200 uL yellow pipette tip refill wafers, 10 wafers of 96 tips (960 tips)
1111-0706 960 Tips

TipOne 200 uL yellow pipette tip refill wafers, 10 wafers of 96 tips (960 tips)

Sign In for Pricing
View Details
Rat Myoglobin (MB) ELISA Kit
AE34156RA-01 48 Tests

Rat Myoglobin (MB) ELISA Kit

Sign In for Pricing
View Details
Rat Myoglobin (MB) ELISA Kit
AE34156RA-02 96 Tests

Rat Myoglobin (MB) ELISA Kit

Sign In for Pricing
View Details
Zebrafish DUSP6 Rabbit Polyclonal Antibody (Carrier-free)
orb3089812 100 µg

Zebrafish DUSP6 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Anti-Glutathione Reductase/GSR Antibody Picoband® (PE Conjugate)
A01479-1-PE 100 µg/Vial

Anti-Glutathione Reductase/GSR Antibody Picoband® (PE Conjugate)

Sign In for Pricing
View Details
RplD Antibody
orb827324 2 mg

RplD Antibody

Sign In for Pricing
View Details