Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae NADPH-dependent methylglyoxal reductase GRE2 (GRE2)

Recombinant Saccharomyces cerevisiae NADPH-dependent methylglyoxal reductase GRE2 (GRE2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) . Target Name: NADPH-dependent methylglyoxal reductase GRE2 (GRE2) . Accession Number: Q12068; GRE2. Expression Region: 1-342aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 51.1kda. Target Synonyms: 3-methylbutanal reductase; Genes de respuesta a estres protein 2; Isovaleraldehyde reductase Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Saccharomyces cerevisiae NADPH-dependent methylglyoxal reductase GRE2 (GRE2) is a purified Recombinant Protein.

Accession Number

Q12068; GRE2

Expression Region

1-342aa

Host

E. coli

Target

NADPH-dependent methylglyoxal reductase GRE2 (GRE2)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

3-methylbutanal reductase; Genes de respuesta a estres protein 2; Isovaleraldehyde reductase

Species

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Protein Name

Recombinant Protein

AA Sequence

MSVFVSGANGFIAQHIVDLLLKEDYKVIGSARSQEKAENLTEAFGNNPKFSMEVVPDISKLDAFDHVFQKHGKDIKIVLHTASPFCFDITDSERDLLIPAVNGVKGILHSIKKYAADSVERVVLTSSYAAVFDMAKENDKSLTFNEESWNPATWESCQSDPVNAYCGSKKFAEKAAWEFLEENRDSVKFELTAVNPVYVFGPQMFDKDVKKHLNTSCELVNSLMHLSPEDKIPELFGGYIDVRDVAKAHLVAFQKRETIGQRLIVSEARFTMQDVLDILNEDFPVLKGNIPVGKPGSGATHNTLGATLDNKKSKKLLGFKFRNLKETIDDTASQILKFEGRI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Matrix Metalloproteinase 2 (MMP-2, Collagenase IV, Gelatinase A) (BSA & Azide Free) (PE) discontinued
M2420-75X-PE 100 µL

Matrix Metalloproteinase 2 (MMP-2, Collagenase IV, Gelatinase A) (BSA & Azide Free) (PE) discontinued

Sign In for Pricing
View Details
SHP2, phosphorylated (Tyr542) (SH2 Domain-containing Protein Tyrosine Phosphatase 2, SHP-2, BPTP3, BPTP-3, CFC, MGC14433, Noonan Syndrome 1, Noonan Syndrome 1 Protein Tyrosine Phosphatase 2C, NS1, Protein Tyrosine Phosphatase 2C, PTP2C, PTP-2C, Protein Ty
MBS624979-01 0.05 mg

SHP2, phosphorylated (Tyr542) (SH2 Domain-containing Protein Tyrosine Phosphatase 2, SHP-2, BPTP3, BPTP-3, CFC, MGC14433, Noonan Syndrome 1, Noonan Syndrome 1 Protein Tyrosine Phosphatase 2C, NS1, Protein Tyrosine Phosphatase 2C, PTP2C, PTP-2C, Protein Ty

Sign In for Pricing
View Details
SHP2, phosphorylated (Tyr542) (SH2 Domain-containing Protein Tyrosine Phosphatase 2, SHP-2, BPTP3, BPTP-3, CFC, MGC14433, Noonan Syndrome 1, Noonan Syndrome 1 Protein Tyrosine Phosphatase 2C, NS1, Protein Tyrosine Phosphatase 2C, PTP2C, PTP-2C, Protein Ty
MBS624979-02 5x 0.05 mg

SHP2, phosphorylated (Tyr542) (SH2 Domain-containing Protein Tyrosine Phosphatase 2, SHP-2, BPTP3, BPTP-3, CFC, MGC14433, Noonan Syndrome 1, Noonan Syndrome 1 Protein Tyrosine Phosphatase 2C, NS1, Protein Tyrosine Phosphatase 2C, PTP2C, PTP-2C, Protein Ty

Sign In for Pricing
View Details
Human CRYBB2 shRNA Plasmid
abx950997-01 150 µg

Human CRYBB2 shRNA Plasmid

Sign In for Pricing
View Details
Human CRYBB2 shRNA Plasmid
abx950997-02 300 µg

Human CRYBB2 shRNA Plasmid

Sign In for Pricing
View Details
PITX2 Antibody, Biotin conjugated
MBS7051099-01 0.05 mg

PITX2 Antibody, Biotin conjugated

Sign In for Pricing
View Details