Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae NADPH-dependent methylglyoxal reductase GRE2 (GRE2)

Recombinant Saccharomyces cerevisiae NADPH-dependent methylglyoxal reductase GRE2 (GRE2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) . Target Name: NADPH-dependent methylglyoxal reductase GRE2 (GRE2) . Accession Number: Q12068; GRE2. Expression Region: 1-342aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 51.1kda. Target Synonyms: 3-methylbutanal reductase; Genes de respuesta a estres protein 2; Isovaleraldehyde reductase Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Saccharomyces cerevisiae NADPH-dependent methylglyoxal reductase GRE2 (GRE2) is a purified Recombinant Protein.

Accession Number

Q12068; GRE2

Expression Region

1-342aa

Host

E. coli

Target

NADPH-dependent methylglyoxal reductase GRE2 (GRE2)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

3-methylbutanal reductase; Genes de respuesta a estres protein 2; Isovaleraldehyde reductase

Species

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Protein Name

Recombinant Protein

AA Sequence

MSVFVSGANGFIAQHIVDLLLKEDYKVIGSARSQEKAENLTEAFGNNPKFSMEVVPDISKLDAFDHVFQKHGKDIKIVLHTASPFCFDITDSERDLLIPAVNGVKGILHSIKKYAADSVERVVLTSSYAAVFDMAKENDKSLTFNEESWNPATWESCQSDPVNAYCGSKKFAEKAAWEFLEENRDSVKFELTAVNPVYVFGPQMFDKDVKKHLNTSCELVNSLMHLSPEDKIPELFGGYIDVRDVAKAHLVAFQKRETIGQRLIVSEARFTMQDVLDILNEDFPVLKGNIPVGKPGSGATHNTLGATLDNKKSKKLLGFKFRNLKETIDDTASQILKFEGRI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SPRYD5 Antibody
NBP3-05825-100ul 100 µL

Rabbit Polyclonal SPRYD5 Antibody

Sign In for Pricing
View Details
Recombinant Human D-glucuronyl C5-epimerase Protein, His, E.coli-10ug
QP6087-ec-10ug 10ug

Recombinant Human D-glucuronyl C5-epimerase Protein, His, E.coli-10ug

Sign In for Pricing
View Details
OCIAD1, CT (OCIAD1, OCIA, OCIA domain-containing protein 1, Ovarian carcinoma immunoreactive antigen) (MaxLight 550)
MBS6327542-01 0.1 mL

OCIAD1, CT (OCIAD1, OCIA, OCIA domain-containing protein 1, Ovarian carcinoma immunoreactive antigen) (MaxLight 550)

Sign In for Pricing
View Details
OCIAD1, CT (OCIAD1, OCIA, OCIA domain-containing protein 1, Ovarian carcinoma immunoreactive antigen) (MaxLight 550)
MBS6327542-02 5x 0.1 mL

OCIAD1, CT (OCIAD1, OCIA, OCIA domain-containing protein 1, Ovarian carcinoma immunoreactive antigen) (MaxLight 550)

Sign In for Pricing
View Details
ELANE Mouse Monoclonal Antibody
AMM81959-01 1 Each

ELANE Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ELANE Mouse Monoclonal Antibody
AMM81959-02 50 µL

ELANE Mouse Monoclonal Antibody

Sign In for Pricing
View Details