Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae NADPH-dependent methylglyoxal reductase GRE2 (GRE2)

Recombinant Saccharomyces cerevisiae NADPH-dependent methylglyoxal reductase GRE2 (GRE2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) . Target Name: NADPH-dependent methylglyoxal reductase GRE2 (GRE2) . Accession Number: Q12068; GRE2. Expression Region: 1-342aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 51.1kda. Target Synonyms: 3-methylbutanal reductase; Genes de respuesta a estres protein 2; Isovaleraldehyde reductase Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Saccharomyces cerevisiae NADPH-dependent methylglyoxal reductase GRE2 (GRE2) is a purified Recombinant Protein.

Accession Number

Q12068; GRE2

Expression Region

1-342aa

Host

E. coli

Target

NADPH-dependent methylglyoxal reductase GRE2 (GRE2)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

3-methylbutanal reductase; Genes de respuesta a estres protein 2; Isovaleraldehyde reductase

Species

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Protein Name

Recombinant Protein

AA Sequence

MSVFVSGANGFIAQHIVDLLLKEDYKVIGSARSQEKAENLTEAFGNNPKFSMEVVPDISKLDAFDHVFQKHGKDIKIVLHTASPFCFDITDSERDLLIPAVNGVKGILHSIKKYAADSVERVVLTSSYAAVFDMAKENDKSLTFNEESWNPATWESCQSDPVNAYCGSKKFAEKAAWEFLEENRDSVKFELTAVNPVYVFGPQMFDKDVKKHLNTSCELVNSLMHLSPEDKIPELFGGYIDVRDVAKAHLVAFQKRETIGQRLIVSEARFTMQDVLDILNEDFPVLKGNIPVGKPGSGATHNTLGATLDNKKSKKLLGFKFRNLKETIDDTASQILKFEGRI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAC2 (AK096924) Human Untagged Clone
SC311813 10 µg

RAC2 (AK096924) Human Untagged Clone

Sign In for Pricing
View Details
Mouse Plxna2 activation kit by CRISPRa
GA203300 1 Kit

Mouse Plxna2 activation kit by CRISPRa

Sign In for Pricing
View Details
Retnlg Protein Lysate (Rat) with C-HA Tag
38834036 100 µg

Retnlg Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Angptl6 (NM_145154) Mouse Untagged Clone
MC203017 10 µg

Angptl6 (NM_145154) Mouse Untagged Clone

Sign In for Pricing
View Details
ARHGEF11 (NM_014784) Human Tagged ORF Clone
RC217976 10 µg

ARHGEF11 (NM_014784) Human Tagged ORF Clone

Sign In for Pricing
View Details
MFSD8 Protein Vector (Rat) (pPM-C-His)
PV282089 500 ng

MFSD8 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details