Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max Leghemoglobin C2

Recombinant Glycine max Leghemoglobin C2 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Glycine max (Soybean) (Glycine hispida) . Target Name: Leghemoglobin C2. Accession Number: P02236; N/A. Expression Region: 2-145aa. Tag Info: N-terminal 6xHis-tagged and C-terminal HA-tagged. Theoretical MW: 20.6kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Glycine max Leghemoglobin C2 is a purified Recombinant Protein.

Accession Number

P02236; N/A

Expression Region

2-145aa

Host

E. coli

Target

Leghemoglobin C2

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged and C-Terminal HA-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Glycine max (Soybean) (Glycine hispida)

Protein Name

Recombinant Protein

AA Sequence

GAFTEKQEALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLSNGVDPSNPKLTGHAEKLFGLVRDSAGQLKANGTVVADAALGSIHAQKAITDPQFVVVKEALLKTIKEAVGDKWSDELSSAWEVAYDELAAAIKKAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Influenza B virus NP Matched Antibody Pair Set [ABP-S-05255]
ABP-S-05255 5 Plates

Influenza B virus NP Matched Antibody Pair Set [ABP-S-05255]

Sign In for Pricing
View Details
Recombinant Lactobacillus plantarum Peptide chain release factor 3 (prfC), partial
MBS1474786 Inquire

Recombinant Lactobacillus plantarum Peptide chain release factor 3 (prfC), partial

Sign In for Pricing
View Details
OsI_16324 Antibody
orb841409 2 mg

OsI_16324 Antibody

Sign In for Pricing
View Details
Anti-Fruit fly cheerio/Filamin Antibody Fluoro550 Conjugated
DZ00502-Fluoro550 200 µL/Vial

Anti-Fruit fly cheerio/Filamin Antibody Fluoro550 Conjugated

Sign In for Pricing
View Details
Hamster Secondary Lymphoid Tissue Chemokine ELISA Kit
MBS029802-01 48 Well

Hamster Secondary Lymphoid Tissue Chemokine ELISA Kit

Sign In for Pricing
View Details
Hamster Secondary Lymphoid Tissue Chemokine ELISA Kit
MBS029802-02 96 Well

Hamster Secondary Lymphoid Tissue Chemokine ELISA Kit

Sign In for Pricing
View Details