Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Multidrug efflux pump subunit AcrA (acrA)

Recombinant E. coli Multidrug efflux pump subunit AcrA (acrA) is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: Multidrug efflux pump subunit AcrA (acrA) . Accession Number: P0AE06; acrA. Expression Region: 25-397aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 46.6kda. Target Synonyms: AcrAB-TolC multidrug efflux pump subunit AcrA; Acridine resistance protein A Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant E. coli Multidrug efflux pump subunit AcrA (acrA) is a purified Recombinant Protein.

Accession Number

P0AE06; acrA

Expression Region

25-397aa

Host

E. coli

Target

Multidrug efflux pump subunit AcrA (acrA)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

AcrAB-TolC multidrug efflux pump subunit AcrA; Acridine resistance protein A

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

CDDKQAQQGGQQMPAVGVVTVKTEPLQITTELPGRTSAYRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQATYDSAKGDLAKAQAAANIAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAAVETARINLAYTKVTSPISGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSNDFLRLKQELANGTLKQENGKAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFPNPDHTLLPGMFVRARLEEGLNPNAILVPQQGVTRTPRGDATVLVVGADDKVETRPIVASQAIGDKWLVTEGLKAGDRVVISGLQKVRPGVQVKAQEVTADNNQQAASGAQPEQSKS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pECMV-Olfr1395-m-FLAG Plasmid
PVT15559 2 µg

pECMV-Olfr1395-m-FLAG Plasmid

Sign In for Pricing
View Details
AdvSHENTEK ® PCV-1 Positive Control
1506744 -R01 100 μL x 3 Tubes

AdvSHENTEK ® PCV-1 Positive Control

Sign In for Pricing
View Details
Rabbit Galectin 1 ELISA Kit
MBS037505 Inquire

Rabbit Galectin 1 ELISA Kit

Sign In for Pricing
View Details
DNAPK antibody (Thr2638)
MBS5302886-01 0.1 mg

DNAPK antibody (Thr2638)

Sign In for Pricing
View Details
DNAPK antibody (Thr2638)
MBS5302886-02 5x 0.1 mg

DNAPK antibody (Thr2638)

Sign In for Pricing
View Details
Cgrrf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7084908 1.0 µg DNA

Cgrrf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details