Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Enterotoxin type C-2 (entC2)

Recombinant Staphylococcus aureus Enterotoxin type C-2 (entC2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus. Target Name: Enterotoxin type C-2 (entC2) . Accession Number: P34071; entC2. Expression Region: 28-266aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 43.6kda. Target Synonyms: SEC2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Staphylococcus aureus Enterotoxin type C-2 (entC2) is a purified Recombinant Protein.

Accession Number

P34071; entC2

Expression Region

28-266aa

Host

E. coli

Target

Enterotoxin type C-2 (entC2)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

43.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

SEC2

Species

Staphylococcus aureus

Protein Name

Recombinant Protein

AA Sequence

ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSV-1-amide UL 26 Open Reading Frame Peptide
abx266638-01 1 mg

HSV-1-amide UL 26 Open Reading Frame Peptide

Sign In for Pricing
View Details
HSV-1-amide UL 26 Open Reading Frame Peptide
abx266638-02 5 mg

HSV-1-amide UL 26 Open Reading Frame Peptide

Sign In for Pricing
View Details
HSV-1-amide UL 26 Open Reading Frame Peptide
abx266638-03 10 mg

HSV-1-amide UL 26 Open Reading Frame Peptide

Sign In for Pricing
View Details
Recombinant Bovine Viral Diarrhea Virus Genome Polyprotein, SUMO-GST
VG9C53-01 100 µg

Recombinant Bovine Viral Diarrhea Virus Genome Polyprotein, SUMO-GST

Sign In for Pricing
View Details
Recombinant Bovine Viral Diarrhea Virus Genome Polyprotein, SUMO-GST
VG9C53-02 500 µg

Recombinant Bovine Viral Diarrhea Virus Genome Polyprotein, SUMO-GST

Sign In for Pricing
View Details
PLEKHA3P1 3'UTR GFP Stable Cell Line
TU068236 1.0 mL

PLEKHA3P1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details