Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Major allergen I polypeptide chain 1 (CH1)

Recombinant Cat Major allergen I polypeptide chain 1 (CH1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Felis catus (Cat) (Felis silvestris catus) . Target Name: Major allergen I polypeptide chain 1 (CH1) . Accession Number: P30438; CH1. Expression Region: 23-92aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 15.3kda. Target Synonyms: AG4; Allergen Cat-1; Allergen Fel d I-A; Allergen FdI; Allergen Fel dI; allergen Fel d 1-A Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Cat Major allergen I polypeptide chain 1 (CH1) is a purified Recombinant Protein.

Accession Number

P30438; CH1

Expression Region

23-92aa

Host

E. coli

Target

Major allergen I polypeptide chain 1 (CH1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

AG4; Allergen Cat-1; Allergen Fel d I-A; Allergen FdI; Allergen Fel dI; allergen Fel d 1-A

Species

Cat (Felis catus; Felis silvestris catus)

Protein Name

Recombinant Protein

AA Sequence

EICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSVLDKIYTSPLC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human DJC13 (His)
orb3067629 50 µg

Recombinant Human DJC13 (His)

Sign In for Pricing
View Details
Rat Vascular Endothelial cell Growth Factor A, VEGF-A ELISA KIT
YLA0001RA-01 48 Tests

Rat Vascular Endothelial cell Growth Factor A, VEGF-A ELISA KIT

Sign In for Pricing
View Details
Rat Vascular Endothelial cell Growth Factor A, VEGF-A ELISA KIT
YLA0001RA-02 96 Tests

Rat Vascular Endothelial cell Growth Factor A, VEGF-A ELISA KIT

Sign In for Pricing
View Details
Recombinant Drosophila sechellia Latrophilin Cirl (Cirl), partial
MBS1124240-01 1 mg (E-Coli)

Recombinant Drosophila sechellia Latrophilin Cirl (Cirl), partial

Sign In for Pricing
View Details
Recombinant Drosophila sechellia Latrophilin Cirl (Cirl), partial
MBS1124240-02 1 mg (Yeast)

Recombinant Drosophila sechellia Latrophilin Cirl (Cirl), partial

Sign In for Pricing
View Details
Rabbit Polyclonal Anti-INTS10 Antibody
TA349543 100 µL

Rabbit Polyclonal Anti-INTS10 Antibody

Sign In for Pricing
View Details