Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rift valley fever virus Non-structural protein NS-S (NSS)

Recombinant Rift valley fever virus Non-structural protein NS-S (NSS) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rift valley fever virus (strain ZH-548 M12) (RVFV) . Target Name: Non-structural protein NS-S (NSS) . Accession Number: P21698; NSS. Expression Region: 1-265aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 37.3kda. Target Synonyms: NSs Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rift valley fever virus Non-structural protein NS-S (NSS) is a purified Recombinant Protein.

Accession Number

P21698; NSS

Expression Region

1-265aa

Host

E. coli

Target

Non-structural protein NS-S (NSS)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

37.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

NSs

Species

Rift valley fever virus (strain ZH-548 M12) (RVFV)

Protein Name

Recombinant Protein

AA Sequence

MDYFPVISVDLQSGRRVVSVEYFRGDGPPRIPYSMVGPCCVFLMHHRPSHEVRLRFSDFYNVGEFPYRVGLGDFASNVAPPPAKPFQRLIDLIGHMTLSDFTRFPNLKEAISWPLGEPSLAFFDLSSTRVHRNDDIRRDQIATLAMRSCKITNDLEDSFAGLHRMIATEAILRGIDLCLLPGFDLMYEVAHVQCVRLLQAAKEDISNAVVPNSALIVLMEESLMLRSSLPSMMGRNNWIPVIPPIPDVEMESEEESDDDGFVEVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAM Human Gene Knockout Kit (CRISPR)
KN202074BN 1 Kit

PAM Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Nitroso Desbutyl Bupivacaina
TRC-N432540-250MG 250 mg

N-Nitroso Desbutyl Bupivacaina

Sign In for Pricing
View Details
PAX7 (PAX7/1187), CF405S conjugate, 0.1mg/mL
BNC041187-500 1x 500 µL

PAX7 (PAX7/1187), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DDX19A Human Gene Knockout Kit (CRISPR)
KN400751 1 Kit

DDX19A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Microtubule Associated Protein 4 (MAP4) ELISA Kit
RD-MAP4-Hu-01 96 Tests

Human Microtubule Associated Protein 4 (MAP4) ELISA Kit

Sign In for Pricing
View Details
Human Microtubule Associated Protein 4 (MAP4) ELISA Kit
RD-MAP4-Hu-02 48 Tests

Human Microtubule Associated Protein 4 (MAP4) ELISA Kit

Sign In for Pricing
View Details