Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage K3 Holin (T), partial

Recombinant Enterobacteria phage K3 Holin (T), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Enterobacteria phage K3 (Bacteriophage K3) . Target Name: Holin (T) . Accession Number: P10393; T. Expression Region: 50-218aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 27.2kda. Target Synonyms: Lysis protein Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Enterobacteria phage K3 Holin (T), partial is a purified Recombinant Protein.

Accession Number

P10393; T

Expression Region

50-218aa

Host

E. coli

Target

Holin (T)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Lysis protein

Species

Enterobacteria phage K3 (Bacteriophage K3)

Protein Name

Recombinant Protein

AA Sequence

RGDSFFEYYKQSKYETYSEIIEKERNARFESVALEQLQIVHISSEADFSAVYSFRPKNLNYFVDIIAYEGKLPSTISEKSLGGYPVDKTMDEYTVHLNGRHYYSNSKFAFLPTKKPTPEINYMYSCPYFNLDNIYAGTITMYWYRNDHISNDRLESICSQAARILGRAK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Linarotene
HY-124142 1 Each

Linarotene

Sign In for Pricing
View Details
Thegl (NM_001017498) Rat Tagged ORF Clone
RR214042 10 µg

Thegl (NM_001017498) Rat Tagged ORF Clone

Sign In for Pricing
View Details
FLAG-Tag (DDDDK Epitope Tag, DYKDDDDK Epitope Tag, DYKDDDDK tag, ECS Epitope Tag, ECS tag, Enterokinase Cleavage Site Epitope Tag, Enterokinase Cleavage Site tag, FLAG) discontinued
347162-01 100 µL

FLAG-Tag (DDDDK Epitope Tag, DYKDDDDK Epitope Tag, DYKDDDDK tag, ECS Epitope Tag, ECS tag, Enterokinase Cleavage Site Epitope Tag, Enterokinase Cleavage Site tag, FLAG) discontinued

Sign In for Pricing
View Details
FLAG-Tag (DDDDK Epitope Tag, DYKDDDDK Epitope Tag, DYKDDDDK tag, ECS Epitope Tag, ECS tag, Enterokinase Cleavage Site Epitope Tag, Enterokinase Cleavage Site tag, FLAG) discontinued
347162-02 200 µL

FLAG-Tag (DDDDK Epitope Tag, DYKDDDDK Epitope Tag, DYKDDDDK tag, ECS Epitope Tag, ECS tag, Enterokinase Cleavage Site Epitope Tag, Enterokinase Cleavage Site tag, FLAG) discontinued

Sign In for Pricing
View Details
Goat anti Human IgM
MBS5317851-01 10 mL

Goat anti Human IgM

Sign In for Pricing
View Details
Goat anti Human IgM
MBS5317851-02 5x 10 mL

Goat anti Human IgM

Sign In for Pricing
View Details