Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Heat-labile enterotoxin B chain (eltB)

Recombinant E. coli Heat-labile enterotoxin B chain (eltB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli. Target Name: Heat-labile enterotoxin B chain (eltB) . Accession Number: P0CK94; eltB. Expression Region: 22-124aa. Tag Info: N-terminal 6xHis-tagged and C-terminal 6xHis-tagged. Theoretical MW: 17kda. Target Synonyms: LT-B; human; LTH-B Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant E. coli Heat-labile enterotoxin B chain (eltB) is a purified Recombinant Protein.

Accession Number

P0CK94; eltB

Expression Region

22-124aa

Host

E. coli

Target

Heat-labile enterotoxin B chain (eltB)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged and C-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

LT-B; human; LTH-B

Species

E. coli

Protein Name

Recombinant Protein

AA Sequence

APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Probable G-protein coupled receptor 151, GPR151 ELISA KIT
ELI-31787h 96 Tests

Human Probable G-protein coupled receptor 151, GPR151 ELISA KIT

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Hermansky Pudlak Syndrome Protein 4 (HPS4)
MBS2083006-01 0.1 mL

FITC-Linked Polyclonal Antibody to Hermansky Pudlak Syndrome Protein 4 (HPS4)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Hermansky Pudlak Syndrome Protein 4 (HPS4)
MBS2083006-02 0.2 mL

FITC-Linked Polyclonal Antibody to Hermansky Pudlak Syndrome Protein 4 (HPS4)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Hermansky Pudlak Syndrome Protein 4 (HPS4)
MBS2083006-03 0.5 mL

FITC-Linked Polyclonal Antibody to Hermansky Pudlak Syndrome Protein 4 (HPS4)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Hermansky Pudlak Syndrome Protein 4 (HPS4)
MBS2083006-04 1 mL

FITC-Linked Polyclonal Antibody to Hermansky Pudlak Syndrome Protein 4 (HPS4)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Hermansky Pudlak Syndrome Protein 4 (HPS4)
MBS2083006-05 5 mL

FITC-Linked Polyclonal Antibody to Hermansky Pudlak Syndrome Protein 4 (HPS4)

Sign In for Pricing
View Details