Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Heat-labile enterotoxin B chain (eltB)

Recombinant E. coli Heat-labile enterotoxin B chain (eltB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli. Target Name: Heat-labile enterotoxin B chain (eltB) . Accession Number: P0CK94; eltB. Expression Region: 22-124aa. Tag Info: N-terminal 6xHis-tagged and C-terminal 6xHis-tagged. Theoretical MW: 17kda. Target Synonyms: LT-B; human; LTH-B Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant E. coli Heat-labile enterotoxin B chain (eltB) is a purified Recombinant Protein.

Accession Number

P0CK94; eltB

Expression Region

22-124aa

Host

E. coli

Target

Heat-labile enterotoxin B chain (eltB)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged and C-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

LT-B; human; LTH-B

Species

E. coli

Protein Name

Recombinant Protein

AA Sequence

APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNORD82 CRISPRa sgRNA lentivector (set of three targets)(Human)
44932121 3x 1.0µg DNA

SNORD82 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
VISTA Stable Cell Line-H
MBS669353-01 1 Vial

VISTA Stable Cell Line-H

Sign In for Pricing
View Details
VISTA Stable Cell Line-H
MBS669353-02 5x1 Vial

VISTA Stable Cell Line-H

Sign In for Pricing
View Details
TG 100572 Hydrochloride
orb1309010 1 mg

TG 100572 Hydrochloride

Sign In for Pricing
View Details
RINZF Lentiviral Activation Particles (m)
sc-432839-LAC 200 µL

RINZF Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
V-SNARE Vti1p (m) : 293T Lysate
sc-124528 100 µg - 200 µL

V-SNARE Vti1p (m) : 293T Lysate

Sign In for Pricing
View Details