Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Type III needle protein PscF (pscF)

Recombinant Pseudomonas aeruginosa Type III needle protein PscF (pscF) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) . Target Name: Type III needle protein PscF (pscF) . Accession Number: P95434; pscF. Expression Region: 2-85aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 16.6kda. Target Synonyms: Pseudomonas secretion protein F Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Pseudomonas aeruginosa Type III needle protein PscF (pscF) is a purified Recombinant Protein.

Accession Number

P95434; pscF

Expression Region

2-85aa

Host

E. coli

Target

Type III needle protein PscF (pscF)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Pseudomonas secretion protein F

Species

Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

Protein Name

Recombinant Protein

AA Sequence

AQIFNPNPGNTLDTVANALKEQANAANKDVNDAIKALQGTDNADNPALLAELQHKINKWSVIYNINSTVTRALRDLMQGILQKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRF (Ab-99) Antibody
8B0088-AAT 50 µg

SRF (Ab-99) Antibody

Sign In for Pricing
View Details
Ppm1j AAV siRNA Pooled Vector
37386164 1.0 µg

Ppm1j AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mouse Hexokinase-2 (HK2) ELISA Kit
MBS2613770-01 48 Well

Mouse Hexokinase-2 (HK2) ELISA Kit

Sign In for Pricing
View Details
Mouse Hexokinase-2 (HK2) ELISA Kit
MBS2613770-02 96 Well

Mouse Hexokinase-2 (HK2) ELISA Kit

Sign In for Pricing
View Details
Mouse Hexokinase-2 (HK2) ELISA Kit
MBS2613770-03 5x 96 Well

Mouse Hexokinase-2 (HK2) ELISA Kit

Sign In for Pricing
View Details
Mouse Hexokinase-2 (HK2) ELISA Kit
MBS2613770-04 10x 96 Well

Mouse Hexokinase-2 (HK2) ELISA Kit

Sign In for Pricing
View Details