Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear receptor subfamily 2 group F member 6 (NR2F6)

Recombinant Human Nuclear receptor subfamily 2 group F member 6 (NR2F6) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Nuclear receptor subfamily 2 group F member 6 (NR2F6) . Accession Number: P10588; NR2F6. Expression Region: 1-404aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 48.9kda. Target Synonyms: V-erbA-related protein 2; EAR-2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Nuclear receptor subfamily 2 group F member 6 (NR2F6) is a purified Recombinant Protein.

Accession Number

P10588; NR2F6

Expression Region

1-404aa

Host

E. coli

Target

Nuclear receptor subfamily 2 group F member 6 (NR2F6)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

48.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

V-erbA-related protein 2; EAR-2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC498145 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6364404 1.0 µg DNA

LOC498145 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
ZFYVE27 CRISPR Activation Plasmid (h)
sc-407267-ACT 20 µg

ZFYVE27 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) YFEO Polyclonal Antibody
MBS9002546 Inquire

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) YFEO Polyclonal Antibody

Sign In for Pricing
View Details
Pglyrp1 Rat Pre-designed siRNA Set A
HY-RS25583 1 Set

Pglyrp1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Tubulin, alpha (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1) (AP)
MBS6257836-01 0.1 mL

Tubulin, alpha (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1) (AP)

Sign In for Pricing
View Details
Tubulin, alpha (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1) (AP)
MBS6257836-02 5x 0.1 mL

Tubulin, alpha (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1) (AP)

Sign In for Pricing
View Details