Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Growth/differentiation factor 9 (GDF9)

Recombinant Sheep Growth/differentiation factor 9 (GDF9) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Sheep (Ovis aries) . Target Name: Growth/differentiation factor 9 (GDF9) . Accession Number: O77681; GDF9. Expression Region: 319-453aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 22.9kda. Target Synonyms: GDF-9 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Sheep Growth/differentiation factor 9 (GDF9) is a purified Recombinant Protein.

Accession Number

O77681; GDF9

Expression Region

319-453aa

Host

E. coli

Target

Growth/differentiation factor 9 (GDF9)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

GDF-9

Species

Sheep (Ovis aries)

Protein Name

Recombinant Protein

AA Sequence

DQESASSELKKPLVPASVNLSEYFKQFLFPQNECELHDFRLSFSQLKWDNWIVAPHKYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIHEKLDSSVPRPSCVPAKYSPLSVLAIEPDGSIAYKEYEDMIATKCTCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Tetradecylhexadecanoic Acid Methyl-d3 Ester
sc-474367 10 mg

2-Tetradecylhexadecanoic Acid Methyl-d3 Ester

Sign In for Pricing
View Details
TJAP1 (Tight Junction Associated Protein 1 (peripheral), DKFZp686F06131, PILT, TJP4)
252685 100 µg

TJAP1 (Tight Junction Associated Protein 1 (peripheral), DKFZp686F06131, PILT, TJP4)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Calcium-binding mitochondrial carrier protein (mcfO)
MBS7019984-01 0.02 mg

Recombinant Dictyostelium discoideum Calcium-binding mitochondrial carrier protein (mcfO)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Calcium-binding mitochondrial carrier protein (mcfO)
MBS7019984-02 0.1 mg

Recombinant Dictyostelium discoideum Calcium-binding mitochondrial carrier protein (mcfO)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Calcium-binding mitochondrial carrier protein (mcfO)
MBS7019984-03 5x 0.1 mg

Recombinant Dictyostelium discoideum Calcium-binding mitochondrial carrier protein (mcfO)

Sign In for Pricing
View Details
Tubulin delta Chain (Delta-tubulin, TUBD, TUBD1) (Biotin)
134894-Biotin 100 µL

Tubulin delta Chain (Delta-tubulin, TUBD, TUBD1) (Biotin)

Sign In for Pricing
View Details