Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Growth/differentiation factor 9 (GDF9)

Recombinant Sheep Growth/differentiation factor 9 (GDF9) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Sheep (Ovis aries) . Target Name: Growth/differentiation factor 9 (GDF9) . Accession Number: O77681; GDF9. Expression Region: 319-453aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 22.9kda. Target Synonyms: GDF-9 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Sheep Growth/differentiation factor 9 (GDF9) is a purified Recombinant Protein.

Accession Number

O77681; GDF9

Expression Region

319-453aa

Host

E. coli

Target

Growth/differentiation factor 9 (GDF9)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

GDF-9

Species

Sheep (Ovis aries)

Protein Name

Recombinant Protein

AA Sequence

DQESASSELKKPLVPASVNLSEYFKQFLFPQNECELHDFRLSFSQLKWDNWIVAPHKYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIHEKLDSSVPRPSCVPAKYSPLSVLAIEPDGSIAYKEYEDMIATKCTCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-APC1 (Ser688) Polyclonal Antibody
bs-12482R 100 µL

Phospho-APC1 (Ser688) Polyclonal Antibody

Sign In for Pricing
View Details
Human CARHSP1 (NM_001278260) AAV Particle
RC236045A1V 250 µL

Human CARHSP1 (NM_001278260) AAV Particle

Sign In for Pricing
View Details
RANGRF (RAN Guanine Nucleotide Release Factor, DKFZp686F02139, HSPC165, HSPC236, MGC110973, MOG1, RANGNRF)
250865 100 µg

RANGRF (RAN Guanine Nucleotide Release Factor, DKFZp686F02139, HSPC165, HSPC236, MGC110973, MOG1, RANGNRF)

Sign In for Pricing
View Details
Lentiviral human XPNPEP3 shRNA (UAS) - Lentiviral human XPNPEP3 shRNA (UAS) plasmid
GTR15348130 1 Vial

Lentiviral human XPNPEP3 shRNA (UAS) - Lentiviral human XPNPEP3 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Human Resistin like molecule β ELISA kit
GTR10474717 96 Well

Human Resistin like molecule β ELISA kit

Sign In for Pricing
View Details
LSM12P1 Protein Vector (Human) (pPM-C-HA)
27742021 500 ng

LSM12P1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details