Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Growth/differentiation factor 9 (GDF9)

Recombinant Sheep Growth/differentiation factor 9 (GDF9) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Sheep (Ovis aries) . Target Name: Growth/differentiation factor 9 (GDF9) . Accession Number: O77681; GDF9. Expression Region: 319-453aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 22.9kda. Target Synonyms: GDF-9 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Sheep Growth/differentiation factor 9 (GDF9) is a purified Recombinant Protein.

Accession Number

O77681; GDF9

Expression Region

319-453aa

Host

E. coli

Target

Growth/differentiation factor 9 (GDF9)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

GDF-9

Species

Sheep (Ovis aries)

Protein Name

Recombinant Protein

AA Sequence

DQESASSELKKPLVPASVNLSEYFKQFLFPQNECELHDFRLSFSQLKWDNWIVAPHKYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIHEKLDSSVPRPSCVPAKYSPLSVLAIEPDGSIAYKEYEDMIATKCTCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Surf5 (BC018225) Mouse Tagged ORF Clone
MG200890 10 µg

Surf5 (BC018225) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Chicken Interleukin 18, IL-18 ELISA KIT
E0240Ch-01 48 Well

Chicken Interleukin 18, IL-18 ELISA KIT

Sign In for Pricing
View Details
Chicken Interleukin 18, IL-18 ELISA KIT
E0240Ch-02 96 Well

Chicken Interleukin 18, IL-18 ELISA KIT

Sign In for Pricing
View Details
Chicken Interleukin 18, IL-18 ELISA KIT
E0240Ch-03 5x 96 Tests

Chicken Interleukin 18, IL-18 ELISA KIT

Sign In for Pricing
View Details
Chicken Interleukin 18, IL-18 ELISA KIT
E0240Ch-04 10x 96 Tests

Chicken Interleukin 18, IL-18 ELISA KIT

Sign In for Pricing
View Details
Bovine U11/U12 Small Nuclear Ribonucleoprotein 35 kDa Protein (SNRNP35) ELISA Kit
MBS9941514-01 48 Well

Bovine U11/U12 Small Nuclear Ribonucleoprotein 35 kDa Protein (SNRNP35) ELISA Kit

Sign In for Pricing
View Details