Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Growth/differentiation factor 9 (GDF9)

Recombinant Sheep Growth/differentiation factor 9 (GDF9) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Sheep (Ovis aries) . Target Name: Growth/differentiation factor 9 (GDF9) . Accession Number: O77681; GDF9. Expression Region: 319-453aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 22.9kda. Target Synonyms: GDF-9 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Sheep Growth/differentiation factor 9 (GDF9) is a purified Recombinant Protein.

Accession Number

O77681; GDF9

Expression Region

319-453aa

Host

E. coli

Target

Growth/differentiation factor 9 (GDF9)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

GDF-9

Species

Sheep (Ovis aries)

Protein Name

Recombinant Protein

AA Sequence

DQESASSELKKPLVPASVNLSEYFKQFLFPQNECELHDFRLSFSQLKWDNWIVAPHKYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIHEKLDSSVPRPSCVPAKYSPLSVLAIEPDGSIAYKEYEDMIATKCTCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Splicing Factor (Arginine/serine-rich 15 (SFRS15) Human ELISA Kit
H2876 96 Tests

Splicing Factor (Arginine/serine-rich 15 (SFRS15) Human ELISA Kit

Sign In for Pricing
View Details
Transferrin Recombinant Antibody, PerCP Conjugated
bsm-61182R-PerCP-TR 20 µL

Transferrin Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
DNER Rabbit pAb
E45R22119N 50 ul

DNER Rabbit pAb

Sign In for Pricing
View Details
SLC20A1 (NM_005415) Human Tagged Lenti ORF Clone
RC201882L3 10 µg

SLC20A1 (NM_005415) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CDX2 (Ab-283) Antibody
E11-8313B 100 µg

CDX2 (Ab-283) Antibody

Sign In for Pricing
View Details
Human recombinant ULBP-6/RAET1L Protein
PROTQ5VY80-100ug 100 µg

Human recombinant ULBP-6/RAET1L Protein

Sign In for Pricing
View Details