Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Cathepsin D (Ctsd)

Recombinant Rat Cathepsin D (Ctsd) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Cathepsin D (Ctsd) . Accession Number: P24268; Ctsd. Expression Region: 65-407aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 45.2kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat Cathepsin D (Ctsd) is a purified Recombinant Protein.

Accession Number

P24268; Ctsd

Expression Region

65-407aa

Host

E. coli

Target

Cathepsin D (Ctsd)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

45.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

EPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDLGGIKVEKQIFGEATKQPGVVFIAAKFDGILGMGYPFISVNKVLPVFDNLMKQKLVEKNIFSFYLNRDPTGQPGGELMLGGTDSRYYHGELSYLNVTRKAYWQVHMDQLEVGSELTLCKGGCEAIVDTGTSLLVGPVDEVKELQKAIGAVPLIQGEYMIPCEKVSSLPIITFKLGGQNYELHPEKYILKVSQAGKTICLSGFMGMDIPPPSGPLWILGDVFIGCYYTVFDREYNRVGFAKAATL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RalA Binding Protein 1 (RALBP1) ELISA Kit
orb2811833-01 48 Tests

Human RalA Binding Protein 1 (RALBP1) ELISA Kit

Sign In for Pricing
View Details
Human RalA Binding Protein 1 (RALBP1) ELISA Kit
orb2811833-02 96 Tests

Human RalA Binding Protein 1 (RALBP1) ELISA Kit

Sign In for Pricing
View Details
Human RalA Binding Protein 1 (RALBP1) ELISA Kit
orb2811833-03 5 x 96 T

Human RalA Binding Protein 1 (RALBP1) ELISA Kit

Sign In for Pricing
View Details
L-Aspartic acid alpha-benzyl ester
260561-01 2 g

L-Aspartic acid alpha-benzyl ester

Sign In for Pricing
View Details
L-Aspartic acid alpha-benzyl ester
260561-02 5 g

L-Aspartic acid alpha-benzyl ester

Sign In for Pricing
View Details
L-Aspartic acid alpha-benzyl ester
260561-03 10 g

L-Aspartic acid alpha-benzyl ester

Sign In for Pricing
View Details