Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial

Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: T-cell surface glycoprotein CD8 alpha chain (CD8A) . Accession Number: P01732; CD8A. Expression Region: 22-182aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 33.6kda. Target Synonyms: T-lymphocyte differentiation antigen T8/Leu-2 CD_antigen: CD8a Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial is a purified Recombinant Protein.

Accession Number

P01732; CD8A

Expression Region

22-182aa

Host

E. coli

Target

T-cell surface glycoprotein CD8 alpha chain (CD8A)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

T-lymphocyte differentiation antigen T8/Leu-2 CD_antigen: CD8a

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Zea mays Unknown protein from spot 146 of 2D-PAGE of etiolated coleoptile
MBS1034740-01 0.05 mg (E-Coli)

Recombinant Zea mays Unknown protein from spot 146 of 2D-PAGE of etiolated coleoptile

Sign In for Pricing
View Details
Recombinant Zea mays Unknown protein from spot 146 of 2D-PAGE of etiolated coleoptile
MBS1034740-02 0.2 mg (E-Coli)

Recombinant Zea mays Unknown protein from spot 146 of 2D-PAGE of etiolated coleoptile

Sign In for Pricing
View Details
Recombinant Zea mays Unknown protein from spot 146 of 2D-PAGE of etiolated coleoptile
MBS1034740-03 0.5 mg (E-Coli)

Recombinant Zea mays Unknown protein from spot 146 of 2D-PAGE of etiolated coleoptile

Sign In for Pricing
View Details
Recombinant Zea mays Unknown protein from spot 146 of 2D-PAGE of etiolated coleoptile
MBS1034740-04 0.05 mg (Yeast)

Recombinant Zea mays Unknown protein from spot 146 of 2D-PAGE of etiolated coleoptile

Sign In for Pricing
View Details
Recombinant Zea mays Unknown protein from spot 146 of 2D-PAGE of etiolated coleoptile
MBS1034740-05 0.05 mg (Baculovirus)

Recombinant Zea mays Unknown protein from spot 146 of 2D-PAGE of etiolated coleoptile

Sign In for Pricing
View Details
Recombinant Zea mays Unknown protein from spot 146 of 2D-PAGE of etiolated coleoptile
MBS1034740-06 0.2 mg (Yeast)

Recombinant Zea mays Unknown protein from spot 146 of 2D-PAGE of etiolated coleoptile

Sign In for Pricing
View Details