Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial

Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: T-cell surface glycoprotein CD8 alpha chain (CD8A) . Accession Number: P01732; CD8A. Expression Region: 22-182aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 33.6kda. Target Synonyms: T-lymphocyte differentiation antigen T8/Leu-2 CD_antigen: CD8a Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial is a purified Recombinant Protein.

Accession Number

P01732; CD8A

Expression Region

22-182aa

Host

E. coli

Target

T-cell surface glycoprotein CD8 alpha chain (CD8A)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

T-lymphocyte differentiation antigen T8/Leu-2 CD_antigen: CD8a

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mus81 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K5008606 1.0 µg DNA

Mus81 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
PYGM Human Over-expression Lysate
orb1357523 100 µg

PYGM Human Over-expression Lysate

Sign In for Pricing
View Details
Eppendorf Centrifuge 5804R Bundle- IVD Only
E5805000360 1 Each

Eppendorf Centrifuge 5804R Bundle- IVD Only

Sign In for Pricing
View Details
GDX Syringe Filter 0.2um PTFE 25mm
FIL2578 1500 / PCK

GDX Syringe Filter 0.2um PTFE 25mm

Sign In for Pricing
View Details
Recombinant Shigella flexneri Aerobic respiration control sensor protein ArcB (arcB), partial
MBS7062460 Inquire

Recombinant Shigella flexneri Aerobic respiration control sensor protein ArcB (arcB), partial

Sign In for Pricing
View Details
P47phox Peptide
abx616460 100 µg

P47phox Peptide

Sign In for Pricing
View Details