Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carbonic anhydrase 1 (CA1)

Recombinant Human Carbonic anhydrase 1 (CA1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Carbonic anhydrase 1 (CA1) . Accession Number: P00915; CA1. Expression Region: 2-261aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 44.7kda. Target Synonyms: Carbonate dehydratase I; Carbonic anhydrase B; CAB; Carbonic anhydrase I; CA-I Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Carbonic anhydrase 1 (CA1) is a purified Recombinant Protein.

Accession Number

P00915; CA1

Expression Region

2-261aa

Host

E. coli

Target

Carbonic anhydrase 1 (CA1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Carbonate dehydratase I; Carbonic anhydrase B; CAB; Carbonic anhydrase I; CA-I

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Schizosaccharomyces pombe Transcriptional regulatory protein sds3 (sds3)
MBS1462845-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Transcriptional regulatory protein sds3 (sds3)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Transcriptional regulatory protein sds3 (sds3)
MBS1462845-02 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe Transcriptional regulatory protein sds3 (sds3)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Transcriptional regulatory protein sds3 (sds3)
MBS1462845-03 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Transcriptional regulatory protein sds3 (sds3)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Transcriptional regulatory protein sds3 (sds3)
MBS1462845-04 0.1 mg (Yeast)

Recombinant Schizosaccharomyces pombe Transcriptional regulatory protein sds3 (sds3)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Transcriptional regulatory protein sds3 (sds3)
MBS1462845-05 0.02 mg (Baculovirus)

Recombinant Schizosaccharomyces pombe Transcriptional regulatory protein sds3 (sds3)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Transcriptional regulatory protein sds3 (sds3)
MBS1462845-06 0.02 mg (Mammalian-Cell)

Recombinant Schizosaccharomyces pombe Transcriptional regulatory protein sds3 (sds3)

Sign In for Pricing
View Details