Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Polycomb complex protein BMI-1 (BMI1), partial

Recombinant Human Polycomb complex protein BMI-1 (BMI1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Polycomb complex protein BMI-1 (BMI1) . Accession Number: P35226; BMI1. Expression Region: 1-250aa. Tag Info: N-terminal GST-tagged. Theoretical MW: 56.4kda. Target Synonyms: Polycomb group RING finger protein 4RING finger protein 51 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Polycomb complex protein BMI-1 (BMI1), partial is a purified Recombinant Protein.

Accession Number

P35226; BMI1

Expression Region

1-250aa

Host

E. coli

Target

Polycomb complex protein BMI-1 (BMI1)

Conjugation

Unconjugated

Tag

N-Terminal GST-Tagged

Field of Research

Transcription

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

56.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Polycomb group RING finger protein 4RING finger protein 51

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MMP1 Antibody Picoband®, Dylight594 Conjugate
A00733-1-Dylight594 100 µg

Anti-MMP1 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
Sprr1b Double Nickase Plasmid (m2)
sc-423137-NIC-2 20 µg

Sprr1b Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
PABPN1 Recombinant Mouse mAb Antibody
orb3016427 100 µL

PABPN1 Recombinant Mouse mAb Antibody

Sign In for Pricing
View Details
Sec31a ORF Vector (Rat) (pORF)
ORF075969 1.0 µg DNA

Sec31a ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Dickkopf Related Protein 3 (DKK3)
MBS2071310-01 0.1 mL

HRP-Linked Polyclonal Antibody to Dickkopf Related Protein 3 (DKK3)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Dickkopf Related Protein 3 (DKK3)
MBS2071310-02 0.2 mL

HRP-Linked Polyclonal Antibody to Dickkopf Related Protein 3 (DKK3)

Sign In for Pricing
View Details