Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Polycomb complex protein BMI-1 (BMI1), partial

Recombinant Human Polycomb complex protein BMI-1 (BMI1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Polycomb complex protein BMI-1 (BMI1) . Accession Number: P35226; BMI1. Expression Region: 1-250aa. Tag Info: N-terminal GST-tagged. Theoretical MW: 56.4kda. Target Synonyms: Polycomb group RING finger protein 4RING finger protein 51 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Polycomb complex protein BMI-1 (BMI1), partial is a purified Recombinant Protein.

Accession Number

P35226; BMI1

Expression Region

1-250aa

Host

E. coli

Target

Polycomb complex protein BMI-1 (BMI1)

Conjugation

Unconjugated

Tag

N-Terminal GST-Tagged

Field of Research

Transcription

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

56.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Polycomb group RING finger protein 4RING finger protein 51

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANGPT2 Adenovirus (Human)
11895051 1.0 mL

ANGPT2 Adenovirus (Human)

Sign In for Pricing
View Details
LZTS2 3'UTR Luciferase Stable Cell Line
TU012820 1.0 mL

LZTS2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
EBI3 sgRNA CRISPR Lentivector (Human) (Target 2)
K0650003 1.0 µg DNA

EBI3 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
PRDX1 Antibody
OAPA00291-5UG 5 µg

PRDX1 Antibody

Sign In for Pricing
View Details
Polyclonal Antibody to Superoxide Dismutase Copper Chaperone
TRV-0054888-01 20 µL

Polyclonal Antibody to Superoxide Dismutase Copper Chaperone

Sign In for Pricing
View Details
Polyclonal Antibody to Superoxide Dismutase Copper Chaperone
TRV-0054888-02 100 µL

Polyclonal Antibody to Superoxide Dismutase Copper Chaperone

Sign In for Pricing
View Details