Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 3-ketoacyl-CoA thiolase, peroxisomal (ACAA1)

Recombinant Human 3-ketoacyl-CoA thiolase, peroxisomal (ACAA1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: 3-ketoacyl-CoA thiolase, peroxisomal (ACAA1) . Accession Number: P09110; ACAA1. Expression Region: 27-331aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 47.9kda. Target Synonyms: Acetyl-CoA acyltrans ferase; Beta-ketothiolase; Peroxisomal 3-oxoacyl-CoA thiolase Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human 3-ketoacyl-CoA thiolase, peroxisomal (ACAA1) is a purified Recombinant Protein.

Accession Number

P09110; ACAA1

Expression Region

27-331aa

Host

E. coli

Target

3-ketoacyl-CoA thiolase, peroxisomal (ACAA1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein of Isoform 2

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

47.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Acetyl-CoA acyltrans ferase; Beta-ketothiolase; Peroxisomal 3-oxoacyl-CoA thiolase

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

LSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MESDC2 Protein Vector (Mouse) (pPM-C-HA)
PV200328 500 ng

MESDC2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Human Cholinergic Receptor, Nicotinic Alpha 1 (CHRNA1) ELISA Kit
abx151060-01 96 Tests

Human Cholinergic Receptor, Nicotinic Alpha 1 (CHRNA1) ELISA Kit

Sign In for Pricing
View Details
Human Cholinergic Receptor, Nicotinic Alpha 1 (CHRNA1) ELISA Kit
abx151060-02 5x 96 Tests

Human Cholinergic Receptor, Nicotinic Alpha 1 (CHRNA1) ELISA Kit

Sign In for Pricing
View Details
Human Cholinergic Receptor, Nicotinic Alpha 1 (CHRNA1) ELISA Kit
abx151060-03 10x 96 Tests

Human Cholinergic Receptor, Nicotinic Alpha 1 (CHRNA1) ELISA Kit

Sign In for Pricing
View Details
SLC22A4 Rabbit pAb
E47R21213 100 µL

SLC22A4 Rabbit pAb

Sign In for Pricing
View Details
C1orf161 3'UTR GFP Stable Cell Line
TU052099 1.0 mL

C1orf161 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details