Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 3-ketoacyl-CoA thiolase, peroxisomal (ACAA1)

Recombinant Human 3-ketoacyl-CoA thiolase, peroxisomal (ACAA1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: 3-ketoacyl-CoA thiolase, peroxisomal (ACAA1) . Accession Number: P09110; ACAA1. Expression Region: 27-331aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 47.9kda. Target Synonyms: Acetyl-CoA acyltrans ferase; Beta-ketothiolase; Peroxisomal 3-oxoacyl-CoA thiolase Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human 3-ketoacyl-CoA thiolase, peroxisomal (ACAA1) is a purified Recombinant Protein.

Accession Number

P09110; ACAA1

Expression Region

27-331aa

Host

E. coli

Target

3-ketoacyl-CoA thiolase, peroxisomal (ACAA1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein of Isoform 2

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

47.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Acetyl-CoA acyltrans ferase; Beta-ketothiolase; Peroxisomal 3-oxoacyl-CoA thiolase

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

LSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Claudin 5 (CLDN5) (MaxLight 490)
C5838-47A-ML490 100 µL

Claudin 5 (CLDN5) (MaxLight 490)

Sign In for Pricing
View Details
Gnat2 (NM_008141) Mouse Tagged Lenti ORF Clone
MR205399L4 10 µg

Gnat2 (NM_008141) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Astacus, intestine t.s.
Cr134c 7.6 x 2.6 cm

Astacus, intestine t.s.

Sign In for Pricing
View Details
Pyruvate Carboxylase Blocking Peptide
CBP1857-01 1 mg

Pyruvate Carboxylase Blocking Peptide

Sign In for Pricing
View Details
Pyruvate Carboxylase Blocking Peptide
CBP1857-02 5 mg

Pyruvate Carboxylase Blocking Peptide

Sign In for Pricing
View Details
Mouse Monoclonal CUL4B Antibody (OTI1C4) [Allophycocyanin]
NBP2-71373APC 0.1 mL

Mouse Monoclonal CUL4B Antibody (OTI1C4) [Allophycocyanin]

Sign In for Pricing
View Details