Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse STEAP1 protein (Steap1)

Recombinant Mouse STEAP1 protein (Steap1) is a purified CF Transmembrane Protein. Purity: >90% as determined by SDS-PAGE. Host: in vitro E. coli expression system. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: STEAP1 protein (Steap1) . Accession Number: Q9CWR7; Steap1. Expression Region: 1-339aa. Tag Info: C-terminal 10xHis-tagged. Theoretical MW: 40.7kda. Target Synonyms: Six-transmembrane epithelial antigen of prostate 1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse STEAP1 protein (Steap1) is a purified CF Transmembrane Protein.

Accession Number

Q9CWR7; Steap1

Expression Region

1-339aa

Host

E. coli

Target

STEAP1 protein (Steap1)

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Six-transmembrane epithelial antigen of prostate 1

Species

Mouse (Mus musculus)

Protein Name

CF Transmembrane Protein

AA Sequence

MEISDDVTNPEQLWKMKPKGNLEDDSYSTKDSGETSMLKRPGLSHLQHAVHVDAFDCPSELQHTQEFFPNWRLPVKVAAIISSLTFLYTLLREIIYPLVTSREQYFYKIPILVINKVLPMVAITLLALVYLPGELAAVVQLRNGTKYKKFPPWLDRWMLARKQFGLLSFFFAVLHAVYSLSYPMRRSYRYKLLNWAYKQVQQNKEDAWVEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTVHALVFAWNKWVDVSQFVWYMPPTFMIAVFLPTLVLICKIALCLPCLRKKILKIRCGWEDVSKINRTEMASRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1QTNF6 (Complement C1q Tumor Necrosis Factor-related Protein 6, CTRP6, UNQ581/PRO1151, ZACRP6)
MBS6000073-01 0.05 mg

C1QTNF6 (Complement C1q Tumor Necrosis Factor-related Protein 6, CTRP6, UNQ581/PRO1151, ZACRP6)

Sign In for Pricing
View Details
C1QTNF6 (Complement C1q Tumor Necrosis Factor-related Protein 6, CTRP6, UNQ581/PRO1151, ZACRP6)
MBS6000073-02 5x 0.05 mg

C1QTNF6 (Complement C1q Tumor Necrosis Factor-related Protein 6, CTRP6, UNQ581/PRO1151, ZACRP6)

Sign In for Pricing
View Details
Human Kallikrein 7, KLK 7 ELISA Kit
MBS702381-01 24 Well (LIMIT 1)

Human Kallikrein 7, KLK 7 ELISA Kit

Sign In for Pricing
View Details
Human Kallikrein 7, KLK 7 ELISA Kit
MBS702381-02 48 Well

Human Kallikrein 7, KLK 7 ELISA Kit

Sign In for Pricing
View Details
Human Kallikrein 7, KLK 7 ELISA Kit
MBS702381-03 96 Well

Human Kallikrein 7, KLK 7 ELISA Kit

Sign In for Pricing
View Details
Human Kallikrein 7, KLK 7 ELISA Kit
MBS702381-04 5x 96 Well

Human Kallikrein 7, KLK 7 ELISA Kit

Sign In for Pricing
View Details