Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 2 Envelope glycoprotein D (gD)

Recombinant Human herpesvirus 2 Envelope glycoprotein D (gD) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: in vitro E. coli expression system. Endotoxin Level: Not Tested. Species: Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2) . Target Name: herpesvirus 2 Envelope glycoprotein D (gD) . Accession Number: Q69467; gD. Expression Region: 26-393aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 42.3kda. Target Synonyms: gD Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human herpesvirus 2 Envelope glycoprotein D (gD) is a purified CF Transmembrane Protein.

Accession Number

Q69467; gD

Expression Region

26-393aa

Host

E. coli

Target

Herpesvirus 2 Envelope glycoprotein D (gD)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

42.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

GD

Species

Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)

Protein Name

CF Transmembrane Protein

AA Sequence

KYALADPSLKMADPNRFRGKNLPVLDQLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQDVAPHHAPAAPSNPGLIIGALAGSTLAVLVIGGIAFWVRRRAQMAPKRLRLPHIRDDDAPPSHQPLFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEM4B rabbit pAb
ES11777-01 50 µL

SEM4B rabbit pAb

Sign In for Pricing
View Details
SEM4B rabbit pAb
ES11777-02 100 µL

SEM4B rabbit pAb

Sign In for Pricing
View Details
PRR3 (NM_025263) Human Untagged Clone
SC305260 10 µg

PRR3 (NM_025263) Human Untagged Clone

Sign In for Pricing
View Details
Mxi1 3'UTR GFP Stable Cell Line
TU263592 1.0 mL

Mxi1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SPARC Lentiviral Activation Particles (h2)
sc-400566-LAC-2 200 µL

SPARC Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Receptor-Type Tyrosine-Protein Phosphatase C / CD45 (PTPRC) Antibody
abx132546-01 100 µL

Receptor-Type Tyrosine-Protein Phosphatase C / CD45 (PTPRC) Antibody

Sign In for Pricing
View Details