Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 2 Envelope glycoprotein D (gD)

Recombinant Human herpesvirus 2 Envelope glycoprotein D (gD) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: in vitro E. coli expression system. Endotoxin Level: Not Tested. Species: Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2) . Target Name: herpesvirus 2 Envelope glycoprotein D (gD) . Accession Number: Q69467; gD. Expression Region: 26-393aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 42.3kda. Target Synonyms: gD Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human herpesvirus 2 Envelope glycoprotein D (gD) is a purified CF Transmembrane Protein.

Accession Number

Q69467; gD

Expression Region

26-393aa

Host

E. coli

Target

Herpesvirus 2 Envelope glycoprotein D (gD)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

42.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

GD

Species

Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)

Protein Name

CF Transmembrane Protein

AA Sequence

KYALADPSLKMADPNRFRGKNLPVLDQLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQDVAPHHAPAAPSNPGLIIGALAGSTLAVLVIGGIAFWVRRRAQMAPKRLRLPHIRDDDAPPSHQPLFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AAK1 Rabbit Polyclonal Antibody
E10G00133 100 µL

AAK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-alpha smooth muscle Actin Rabbit Monoclonal Antibody
MBS179544-01 0.03 mL

Anti-alpha smooth muscle Actin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-alpha smooth muscle Actin Rabbit Monoclonal Antibody
MBS179544-02 0.1 mL

Anti-alpha smooth muscle Actin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-alpha smooth muscle Actin Rabbit Monoclonal Antibody
MBS179544-03 5x 0.1 mL

Anti-alpha smooth muscle Actin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
OR6C66P Adenovirus (Human)
35497051 1.0 mL

OR6C66P Adenovirus (Human)

Sign In for Pricing
View Details
Recombinant Human CD14 CHO derived
7-04711 10 µg

Recombinant Human CD14 CHO derived

Sign In for Pricing
View Details