Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Putative ZDHHC-type palmitoyltransferase 8 (DDB_G0280329)

Recombinant Dictyostelium discoideum Putative ZDHHC-type palmitoyltransferase 8 (DDB_G0280329) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: in vitro E. coli expression system. Endotoxin Level: Not Tested. Species: Dictyostelium discoideum (Slime mold) . Target Name: Putative ZDHHC-type palmitoyltransferase 8 (DDB_G0280329) . Accession Number: Q54VH7; DDB_G0280329. Expression Region: 1-375aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 49.9kda. Target Synonyms: Zinc finger DHHC domain-containing protein 8 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Dictyostelium discoideum Putative ZDHHC-type palmitoyltransferase 8 (DDB_G0280329) is a purified CF Transmembrane Protein.

Accession Number

Q54VH7; DDB_G0280329

Expression Region

1-375aa

Host

E. coli

Target

Putative ZDHHC-type palmitoyltransferase 8 (DDB_G0280329)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

49.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Zinc finger DHHC domain-containing protein 8

Species

Dictyostelium discoideum (Slime mold)

Protein Name

CF Transmembrane Protein

AA Sequence

MIDLFDFVVLSSFIILLPLVTDFLNNTFPNAKIGRLAQEVVGMILVFFIVSLIFAGVSLWYTHFLPFYYTKSLLISFDTLNLLDLLKFINTDNNNNSGSSIFNKITFYFHIFFTIQLVVNLYYYYYQTITADNFLPKISKNKQIQLFASETTTTTTTTTDNINEKKNKLCGLCDQVSDGKWSTINKPKSHHCRICKRCIDSMDHHCPFAANCIGINNHHYFILFIGYTVMALIYACYLSFFPYYHCIVNYKNYVSLSFTNDNDNDNNNNNNFKQLAQSCAKFNKYSFIFLCCCLIVTASFGILLFQTYLIITNSKTVQLLSRLKKSKSFLDWFKWLYQNFKQNASINNIYSLFPNFKFYNLIIPYYKRKINKLNK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Keratin, Type II Cuticular Hb6 (KRT86) ELISA Kit
MBS9363742-01 48 Well

Rat Keratin, Type II Cuticular Hb6 (KRT86) ELISA Kit

Sign In for Pricing
View Details
Rat Keratin, Type II Cuticular Hb6 (KRT86) ELISA Kit
MBS9363742-02 96 Well

Rat Keratin, Type II Cuticular Hb6 (KRT86) ELISA Kit

Sign In for Pricing
View Details
Rat Keratin, Type II Cuticular Hb6 (KRT86) ELISA Kit
MBS9363742-03 5x 96 Well

Rat Keratin, Type II Cuticular Hb6 (KRT86) ELISA Kit

Sign In for Pricing
View Details
Rat Keratin, Type II Cuticular Hb6 (KRT86) ELISA Kit
MBS9363742-04 10x 96 Well

Rat Keratin, Type II Cuticular Hb6 (KRT86) ELISA Kit

Sign In for Pricing
View Details
Human Ubiquitin Specific Peptidase 7 (USP7) ELISA Kit
CK-bio-27861-01 48 Tests

Human Ubiquitin Specific Peptidase 7 (USP7) ELISA Kit

Sign In for Pricing
View Details
Human Ubiquitin Specific Peptidase 7 (USP7) ELISA Kit
CK-bio-27861-02 96 Tests

Human Ubiquitin Specific Peptidase 7 (USP7) ELISA Kit

Sign In for Pricing
View Details