Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Outer membrane protein A (ompA)

Recombinant E. coli Outer membrane protein A (ompA) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: in vitro E. coli expression system. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: Outer membrane protein A (ompA) . Accession Number: P0A910; ompA. Expression Region: 22-346aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 38.0kda. Target Synonyms: Outer membrane protein II; con; tolG; tut Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant E. coli Outer membrane protein A (ompA) is a purified CF Transmembrane Protein.

Accession Number

P0A910; ompA

Expression Region

22-346aa

Host

E. coli

Target

Outer membrane protein A (ompA)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Outer membrane protein II; con; tolG; tut

Species

E. coli (strain K12)

Protein Name

CF Transmembrane Protein

AA Sequence

APKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASC3 CytoSection
TS408495P5 25 Slides

CASC3 CytoSection

Sign In for Pricing
View Details
Recombinant Human CGI-09 Protein - (Dry Ice)
H00051605-P01-2ug 2 µg

Recombinant Human CGI-09 Protein - (Dry Ice)

Sign In for Pricing
View Details
Anti-Prostein Antibody
bs-70871R 100 µL

Anti-Prostein Antibody

Sign In for Pricing
View Details
MAGI3 Protein Lysate (Mouse) with C-HA Tag
27957034 100 µg

MAGI3 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Zcchc8 (BC013555) Mouse Tagged ORF Clone Lentiviral Particle
MR207490L4V 200 µL

Zcchc8 (BC013555) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GENLISA Human Importin 9 (IPO9) ELISA
KBH11934 1x 96 Well

GENLISA Human Importin 9 (IPO9) ELISA

Sign In for Pricing
View Details