Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Outer membrane protein A (ompA)

Recombinant E. coli Outer membrane protein A (ompA) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: in vitro E. coli expression system. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: Outer membrane protein A (ompA) . Accession Number: P0A910; ompA. Expression Region: 22-346aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 38.0kda. Target Synonyms: Outer membrane protein II; con; tolG; tut Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant E. coli Outer membrane protein A (ompA) is a purified CF Transmembrane Protein.

Accession Number

P0A910; ompA

Expression Region

22-346aa

Host

E. coli

Target

Outer membrane protein A (ompA)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Outer membrane protein II; con; tolG; tut

Species

E. coli (strain K12)

Protein Name

CF Transmembrane Protein

AA Sequence

APKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r117 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3082304 1.0 µg DNA

Vmn1r117 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Human Oncoprotein Induced Transcript 3 (OIT3) ELISA Kit
MBS2703644-01 24 Strip Well

Human Oncoprotein Induced Transcript 3 (OIT3) ELISA Kit

Sign In for Pricing
View Details
Human Oncoprotein Induced Transcript 3 (OIT3) ELISA Kit
MBS2703644-02 48 Well

Human Oncoprotein Induced Transcript 3 (OIT3) ELISA Kit

Sign In for Pricing
View Details
Human Oncoprotein Induced Transcript 3 (OIT3) ELISA Kit
MBS2703644-03 96 Well

Human Oncoprotein Induced Transcript 3 (OIT3) ELISA Kit

Sign In for Pricing
View Details
Human Oncoprotein Induced Transcript 3 (OIT3) ELISA Kit
MBS2703644-04 5x 96 Well

Human Oncoprotein Induced Transcript 3 (OIT3) ELISA Kit

Sign In for Pricing
View Details
Human Oncoprotein Induced Transcript 3 (OIT3) ELISA Kit
MBS2703644-05 10x 96 Well

Human Oncoprotein Induced Transcript 3 (OIT3) ELISA Kit

Sign In for Pricing
View Details