Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Translocator protein (Tspo)

Recombinant Mouse Translocator protein (Tspo) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: in vitro E. coli expression system. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Translocator protein (Tspo) . Accession Number: P50637; Tspo. Expression Region: 1-169aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 21.7kda. Target Synonyms: Mitochondrial benzodiazepine receptor; PKBS; Peripheral-type benzodiazepine receptor; PBR; Bzrp; Mbr Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Translocator protein (Tspo) is a purified CF Transmembrane Protein.

Accession Number

P50637; Tspo

Expression Region

1-169aa

Host

E. coli

Target

Translocator protein (Tspo)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Mitochondrial benzodiazepine receptor; PKBS; Peripheral-type benzodiazepine receptor; PBR; Bzrp; Mbr

Species

Mouse (Mus musculus)

Protein Name

CF Transmembrane Protein

AA Sequence

MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNM3 Polyclonal Antibody
MBS2566653-01 0.06 mL

DNM3 Polyclonal Antibody

Sign In for Pricing
View Details
DNM3 Polyclonal Antibody
MBS2566653-02 0.12 mL

DNM3 Polyclonal Antibody

Sign In for Pricing
View Details
DNM3 Polyclonal Antibody
MBS2566653-03 0.2 mL

DNM3 Polyclonal Antibody

Sign In for Pricing
View Details
DNM3 Polyclonal Antibody
MBS2566653-04 5x 0.2 mL

DNM3 Polyclonal Antibody

Sign In for Pricing
View Details
Rat Eomesodermin ELISA Kit
MBS078844-01 48 Well

Rat Eomesodermin ELISA Kit

Sign In for Pricing
View Details
Rat Eomesodermin ELISA Kit
MBS078844-02 96 Well

Rat Eomesodermin ELISA Kit

Sign In for Pricing
View Details