Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cannabinoid receptor 2 (Cnr2)

Recombinant Mouse Cannabinoid receptor 2 (Cnr2) is a purified CF Transmembrane Protein. Purity: >95% as determined by SDS-PAGE. Host: in vitro E. coli expression system. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Cannabinoid receptor 2 (Cnr2) . Accession Number: P47936; Cnr2. Expression Region: 1-347aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 41.0kda. Target Synonyms: CB-2; CB2; mCB2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Cannabinoid receptor 2 (Cnr2) is a purified CF Transmembrane Protein.

Accession Number

P47936; Cnr2

Expression Region

1-347aa

Host

E. coli

Target

Cannabinoid receptor 2 (Cnr2)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CB-2; CB2; mCB2

Species

Mouse (Mus musculus)

Protein Name

CF Transmembrane Protein

AA Sequence

MEGCRETEVTNGSNGGLEFNPMKEYMILSSGQQIAVAVLCTLMGLLSALENMAVLYIILSSRRLRRKPSYLFISSLAGADFLASVIFACNFVIFHVFHGVDSNAIFLLKIGSVTMTFTASVGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALCVMWVLSALISYLPLMGWTCCPSPCSELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHRHVATLAEHQDRQVPGIARMRLDVRLAKTLGLVLAVLLICWFPALALMGHSLVTTLSDQVKEAFAFCSMLCLVNSMVNPIIYALRSGEIRSAAQHCLIGWKKYLQGLGPEGKEEGPRSSVTETEADVKTT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDX4 (Caudal Type Homeobox 4) (MaxLight 550)
MBS6216289-01 0.1 mL

CDX4 (Caudal Type Homeobox 4) (MaxLight 550)

Sign In for Pricing
View Details
CDX4 (Caudal Type Homeobox 4) (MaxLight 550)
MBS6216289-02 5x 0.1 mL

CDX4 (Caudal Type Homeobox 4) (MaxLight 550)

Sign In for Pricing
View Details
Pancreatic Polypeptide (MaxLight 490) discontinued
P3000-10H-ML490 100 µL

Pancreatic Polypeptide (MaxLight 490) discontinued

Sign In for Pricing
View Details
MOB1B AAV Vector (Mouse) (CMV)
30278104 1 µg

MOB1B AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
EIF2AK1 Knockout Cell Lysate
ABC-KC0586 100 µg

EIF2AK1 Knockout Cell Lysate

Sign In for Pricing
View Details
Lentiviral mouse Bex4 shRNA (UAS) - Lentiviral mouseBex4 shRNA (UAS, GFP) (25)
GTR15287144 1 Vial

Lentiviral mouse Bex4 shRNA (UAS) - Lentiviral mouseBex4 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details