Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cannabinoid receptor 2 (Cnr2)

Recombinant Mouse Cannabinoid receptor 2 (Cnr2) is a purified CF Transmembrane Protein. Purity: >95% as determined by SDS-PAGE. Host: in vitro E. coli expression system. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Cannabinoid receptor 2 (Cnr2) . Accession Number: P47936; Cnr2. Expression Region: 1-347aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 41.0kda. Target Synonyms: CB-2; CB2; mCB2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Cannabinoid receptor 2 (Cnr2) is a purified CF Transmembrane Protein.

Accession Number

P47936; Cnr2

Expression Region

1-347aa

Host

E. coli

Target

Cannabinoid receptor 2 (Cnr2)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CB-2; CB2; mCB2

Species

Mouse (Mus musculus)

Protein Name

CF Transmembrane Protein

AA Sequence

MEGCRETEVTNGSNGGLEFNPMKEYMILSSGQQIAVAVLCTLMGLLSALENMAVLYIILSSRRLRRKPSYLFISSLAGADFLASVIFACNFVIFHVFHGVDSNAIFLLKIGSVTMTFTASVGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALCVMWVLSALISYLPLMGWTCCPSPCSELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHRHVATLAEHQDRQVPGIARMRLDVRLAKTLGLVLAVLLICWFPALALMGHSLVTTLSDQVKEAFAFCSMLCLVNSMVNPIIYALRSGEIRSAAQHCLIGWKKYLQGLGPEGKEEGPRSSVTETEADVKTT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPPA sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1449108 1.0 µg DNA

NPPA sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
EphA2 Receptor, CT (Ephrin Type-A Receptor 2, Tyrosine-protein Kinase Receptor ECK, Epithelial Cell Kinase, ECK) (Biotin)
MBS6474203-01 0.2 mL

EphA2 Receptor, CT (Ephrin Type-A Receptor 2, Tyrosine-protein Kinase Receptor ECK, Epithelial Cell Kinase, ECK) (Biotin)

Sign In for Pricing
View Details
EphA2 Receptor, CT (Ephrin Type-A Receptor 2, Tyrosine-protein Kinase Receptor ECK, Epithelial Cell Kinase, ECK) (Biotin)
MBS6474203-02 5x 0.2 mL

EphA2 Receptor, CT (Ephrin Type-A Receptor 2, Tyrosine-protein Kinase Receptor ECK, Epithelial Cell Kinase, ECK) (Biotin)

Sign In for Pricing
View Details
Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) CSN9 Polyclonal Antibody
MBS7199347 Inquire

Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) CSN9 Polyclonal Antibody

Sign In for Pricing
View Details
Ly49i5 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6389802 1.0 µg DNA

Ly49i5 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
DENND2D (NM_001271833) Human Untagged Clone
SC333127 10 µg

DENND2D (NM_001271833) Human Untagged Clone

Sign In for Pricing
View Details