Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CCN family member 5 (Ccn5)

Recombinant Mouse CCN family member 5 (Ccn5) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: CCN family member 5 (Ccn5) . Accession Number: Q9Z0G4; Ccn5. Expression Region: 24-251aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 40.5kda. Target Synonyms: CCN family member 5Connective tissue growth factor-like protein; CTGF-L Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse CCN family member 5 (Ccn5) is a purified Recombinant Protein.

Accession Number

Q9Z0G4; Ccn5

Expression Region

24-251aa

Host

E. coli

Target

CCN family member 5 (Ccn5)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CCN family member 5Connective tissue growth factor-like protein; CTGF-L

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS18 Rabbit Polyclonal Antibody
BT-AP13454-01 20 µL

VPS18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VPS18 Rabbit Polyclonal Antibody
BT-AP13454-02 50 µL

VPS18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VPS18 Rabbit Polyclonal Antibody
BT-AP13454-03 100 µL

VPS18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Alpha-actinin-1 (ACTN1) ELISA Kit
MBS2805403-01 48 Tests

Mouse Alpha-actinin-1 (ACTN1) ELISA Kit

Sign In for Pricing
View Details
Mouse Alpha-actinin-1 (ACTN1) ELISA Kit
MBS2805403-02 96 Tests

Mouse Alpha-actinin-1 (ACTN1) ELISA Kit

Sign In for Pricing
View Details
Mouse Alpha-actinin-1 (ACTN1) ELISA Kit
MBS2805403-03 5x 96 Tests

Mouse Alpha-actinin-1 (ACTN1) ELISA Kit

Sign In for Pricing
View Details