Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pediococcus acidilactici Bacteriocin pediocin PA-1 (pedA)

Recombinant Pediococcus acidilactici Bacteriocin pediocin PA-1 (pedA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pediococcus acidilactici. Target Name: Bacteriocin pediocin PA-1 (pedA) . Accession Number: P29430; pedA. Expression Region: 19-62aa. Tag Info: N-terminal 6xHis-KSI-tagged. Theoretical MW: 20.0kda. Target Synonyms: Pediocin ACH Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Pediococcus acidilactici Bacteriocin pediocin PA-1 (pedA) is a purified Recombinant Protein.

Accession Number

P29430; pedA

Expression Region

19-62aa

Host

E. coli

Target

Bacteriocin pediocin PA-1 (pedA)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-KSI-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Pediocin ACH

Species

Pediococcus acidilactici

Protein Name

Recombinant Protein

AA Sequence

KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human T-cell surface glycoprotein CD1a (CD1A) ELISA Kit
AE61504HU-01 48 Tests

Human T-cell surface glycoprotein CD1a (CD1A) ELISA Kit

Sign In for Pricing
View Details
Human T-cell surface glycoprotein CD1a (CD1A) ELISA Kit
AE61504HU-02 96 Tests

Human T-cell surface glycoprotein CD1a (CD1A) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal ARNT2 Antibody (1B2)
H00009915-M03 0.1 mg

Mouse Monoclonal ARNT2 Antibody (1B2)

Sign In for Pricing
View Details
Mouse Monoclonal Fc gamma RIIA/CD32a Antibody (7.3) [PE/Cy5.5]
NBP2-47830PECY55 0.1 mL

Mouse Monoclonal Fc gamma RIIA/CD32a Antibody (7.3) [PE/Cy5.5]

Sign In for Pricing
View Details
Human WNT7B (Protein Wnt-7b) ELISA Kit
EH2311 96 Tests

Human WNT7B (Protein Wnt-7b) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human EGFRvIII Protein, C-Fc
E55P5311 50 µg

Recombinant Human EGFRvIII Protein, C-Fc

Sign In for Pricing
View Details