Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Extracellular calcium-sensing receptor (CASR), partial

Recombinant Human Extracellular calcium-sensing receptor (CASR), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Extracellular calcium-sensing receptor (CASR) . Accession Number: P41180; CASR. Expression Region: 20-612aa. Tag Info: N-terminal GST-tagged. Theoretical MW: 93.6kda. Target Synonyms: Parathyroid cell calcium-sensing receptor 1; PCaR1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Extracellular calcium-sensing receptor (CASR), partial is a purified Recombinant Protein.

Accession Number

P41180; CASR

Expression Region

20-612aa

Host

E. coli

Target

Extracellular calcium-sensing receptor (CASR)

Conjugation

Unconjugated

Tag

N-Terminal GST-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial of Isoform 2

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

93.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Parathyroid cell calcium-sensing receptor 1; PCaR1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

YGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIAKEIEFLSWTEPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Breast Cancer Cells [MDA-MB-415]
AFG-ELL-0073 > 1x 10^6 Cells / Vial

Human Breast Cancer Cells [MDA-MB-415]

Sign In for Pricing
View Details
Mouse Anti-Meningitis B Neisserial adhesin A (NadA) IgG ELISA kit, 96 tests, quantitative
600-905-MNG 1 Kit

Mouse Anti-Meningitis B Neisserial adhesin A (NadA) IgG ELISA kit, 96 tests, quantitative

Sign In for Pricing
View Details
Synuclein, alpha (Non-A beta Component Of AD Amyloid, Non-A4 Component Of Amyloid Precursor, NACP, SNCA, PARK1) discontinued
S9500-22D-01 50 µg

Synuclein, alpha (Non-A beta Component Of AD Amyloid, Non-A4 Component Of Amyloid Precursor, NACP, SNCA, PARK1) discontinued

Sign In for Pricing
View Details
Synuclein, alpha (Non-A beta Component Of AD Amyloid, Non-A4 Component Of Amyloid Precursor, NACP, SNCA, PARK1) discontinued
S9500-22D-02 100 µg

Synuclein, alpha (Non-A beta Component Of AD Amyloid, Non-A4 Component Of Amyloid Precursor, NACP, SNCA, PARK1) discontinued

Sign In for Pricing
View Details
Recombinant Human ACYP2 Protein - (Dry Ice)
H00000098-P01-25ug 25 µg

Recombinant Human ACYP2 Protein - (Dry Ice)

Sign In for Pricing
View Details
Mouse Super Oxidase Dimutase (SOD) ELISA Kit
QY-E21411 96 Tests

Mouse Super Oxidase Dimutase (SOD) ELISA Kit

Sign In for Pricing
View Details