Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Extracellular calcium-sensing receptor (CASR), partial

Recombinant Human Extracellular calcium-sensing receptor (CASR), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Extracellular calcium-sensing receptor (CASR) . Accession Number: P41180; CASR. Expression Region: 20-612aa. Tag Info: N-terminal GST-tagged. Theoretical MW: 93.6kda. Target Synonyms: Parathyroid cell calcium-sensing receptor 1; PCaR1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Extracellular calcium-sensing receptor (CASR), partial is a purified Recombinant Protein.

Accession Number

P41180; CASR

Expression Region

20-612aa

Host

E. coli

Target

Extracellular calcium-sensing receptor (CASR)

Conjugation

Unconjugated

Tag

N-Terminal GST-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial of Isoform 2

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

93.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Parathyroid cell calcium-sensing receptor 1; PCaR1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

YGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIAKEIEFLSWTEPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nt5c sgRNA CRISPR Lentivector set (Mouse)
K3556301 3x 1.0 µg

Nt5c sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Human OR56A3 (NM_001003443) AAV Particle
RC213805A1V 250 µL

Human OR56A3 (NM_001003443) AAV Particle

Sign In for Pricing
View Details
NDUFA4L2 sgRNA CRISPR Lentivector (Human) (Target 2)
K1408503 1.0 µg DNA

NDUFA4L2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
AGL Human Over-expression Lysate
orb1341837 100 µg

AGL Human Over-expression Lysate

Sign In for Pricing
View Details
Rat CaM kinase like vesicle associated protein (CAMKV) ELISA kit
GTR10462633 96 Well

Rat CaM kinase like vesicle associated protein (CAMKV) ELISA kit

Sign In for Pricing
View Details
Mouse IgG (Fc) Antibody (HRP)
GWB-2508B1 1 mg

Mouse IgG (Fc) Antibody (HRP)

Sign In for Pricing
View Details