Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Granzyme C (Gzmc)

Recombinant Mouse Granzyme C (Gzmc) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Granzyme C (Gzmc) . Accession Number: P08882; Gzmc. Expression Region: 21-248aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 32.6kda. Target Synonyms: B10; Cytotoxic cell protease 2; CCP2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Granzyme C (Gzmc) is a purified Recombinant Protein.

Accession Number

P08882; Gzmc

Expression Region

21-248aa

Host

E. coli

Target

Granzyme C (Gzmc)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

B10; Cytotoxic cell protease 2; CCP2

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

IIGGNEISPHSRPYMAYYEFLKVGGKKMFCGGFLVRDKFVLTAAHCKGSSMTVTLGAHNIKAKEETQQIIPVAKAIPHPDYNPDDRSNDIMLLKLVRNAKRTRAVRPLNLPRRNAHVKPGDECYVAGWGKVTPDGEFPKTLHEVKLTVQKDQVCESQFQSSYNRANEICVGDSKIKGASFEEDSGGPLVCKRAAAGIVSYGQTDGSAPQVFTRVLSFVSWIKKTMKHS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF74 Polyclonal Antibody PE Conjugated
MBS9463929-01 0.1 mL

RNF74 Polyclonal Antibody PE Conjugated

Sign In for Pricing
View Details
RNF74 Polyclonal Antibody PE Conjugated
MBS9463929-02 5x 0.1 mL

RNF74 Polyclonal Antibody PE Conjugated

Sign In for Pricing
View Details
hnRNP U (HNRNPU) Human siRNA Oligo Duplex (Locus ID 3192)
SR302175 1 Kit

hnRNP U (HNRNPU) Human siRNA Oligo Duplex (Locus ID 3192)

Sign In for Pricing
View Details
CYP20A1 Rabbit Polyclonal Antibody
TA315658 100 µL

CYP20A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
mmu-miR-6930-5p miRNA Antagomir
MNM02606 2x 5.0 nmol

mmu-miR-6930-5p miRNA Antagomir

Sign In for Pricing
View Details
Hepatitis B Virus E Antigen Goat polyclonal antibody-FITC labled
E38PA9948 100 µL

Hepatitis B Virus E Antigen Goat polyclonal antibody-FITC labled

Sign In for Pricing
View Details