Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Granzyme C (Gzmc)

Recombinant Mouse Granzyme C (Gzmc) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Granzyme C (Gzmc) . Accession Number: P08882; Gzmc. Expression Region: 21-248aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 32.6kda. Target Synonyms: B10; Cytotoxic cell protease 2; CCP2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Granzyme C (Gzmc) is a purified Recombinant Protein.

Accession Number

P08882; Gzmc

Expression Region

21-248aa

Host

E. coli

Target

Granzyme C (Gzmc)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

B10; Cytotoxic cell protease 2; CCP2

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

IIGGNEISPHSRPYMAYYEFLKVGGKKMFCGGFLVRDKFVLTAAHCKGSSMTVTLGAHNIKAKEETQQIIPVAKAIPHPDYNPDDRSNDIMLLKLVRNAKRTRAVRPLNLPRRNAHVKPGDECYVAGWGKVTPDGEFPKTLHEVKLTVQKDQVCESQFQSSYNRANEICVGDSKIKGASFEEDSGGPLVCKRAAAGIVSYGQTDGSAPQVFTRVLSFVSWIKKTMKHS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK726701A 10mg
A20101-10 10 mg

GSK726701A 10mg

Sign In for Pricing
View Details
C2ORF29 (CNOT11) Human Gene Knockout Kit (CRISPR)
KN409407 1 Kit

C2ORF29 (CNOT11) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human CT47A11 Protein - (Dry Ice)
H00255313-P01-10ug 10 µg

Recombinant Human CT47A11 Protein - (Dry Ice)

Sign In for Pricing
View Details
Cyclosporin C
TRC-C988905-10MG 10 mg

Cyclosporin C

Sign In for Pricing
View Details
SUPT5H, ID (SUPT5H, SPT5, SPT5H, Transcription elongation factor SPT5, DRB sensitivity-inducing factor 160kD subunit, DRB sensitivity-inducing factor large subunit, Tat-cotransactivator 1 protein) (Biotin)
MBS6352634-01 0.2 mL

SUPT5H, ID (SUPT5H, SPT5, SPT5H, Transcription elongation factor SPT5, DRB sensitivity-inducing factor 160kD subunit, DRB sensitivity-inducing factor large subunit, Tat-cotransactivator 1 protein) (Biotin)

Sign In for Pricing
View Details
SUPT5H, ID (SUPT5H, SPT5, SPT5H, Transcription elongation factor SPT5, DRB sensitivity-inducing factor 160kD subunit, DRB sensitivity-inducing factor large subunit, Tat-cotransactivator 1 protein) (Biotin)
MBS6352634-02 5x 0.2 mL

SUPT5H, ID (SUPT5H, SPT5, SPT5H, Transcription elongation factor SPT5, DRB sensitivity-inducing factor 160kD subunit, DRB sensitivity-inducing factor large subunit, Tat-cotransactivator 1 protein) (Biotin)

Sign In for Pricing
View Details