Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB)

Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Enterobacteria phage H19B (Bacteriophage H19B) . Target Name: Shiga-like toxin 1 subunit B (stxB) . Accession Number: P69179; stxB. Expression Region: 21-89aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 11.7kda. Target Synonyms: Verocytotoxin 1 subunit B Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB) is a purified Recombinant Protein.

Accession Number

P69179; stxB

Expression Region

21-89aa

Host

E. coli

Target

Shiga-like toxin 1 subunit B (stxB)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

11.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Verocytotoxin 1 subunit B

Species

Enterobacteria phage H19B (Bacteriophage H19B)

Protein Name

Recombinant Protein

AA Sequence

TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Beta-glucosidase, B-GLU ELISA KIT
E0853Hu-01 48 Well

Human Beta-glucosidase, B-GLU ELISA KIT

Sign In for Pricing
View Details
Human Beta-glucosidase, B-GLU ELISA KIT
E0853Hu-02 96 Well

Human Beta-glucosidase, B-GLU ELISA KIT

Sign In for Pricing
View Details
Human Beta-glucosidase, B-GLU ELISA KIT
E0853Hu-03 5x 96 Tests

Human Beta-glucosidase, B-GLU ELISA KIT

Sign In for Pricing
View Details
Human Beta-glucosidase, B-GLU ELISA KIT
E0853Hu-04 10x 96 Tests

Human Beta-glucosidase, B-GLU ELISA KIT

Sign In for Pricing
View Details
Recombinant Pasteurella Multocida erpA Protein (aa 1-114)
VAng-Cr6800-50gEcoli 50 µg (E. coli)

Recombinant Pasteurella Multocida erpA Protein (aa 1-114)

Sign In for Pricing
View Details
MEM complete medium
CRP160 100 mL

MEM complete medium

Sign In for Pricing
View Details