Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB)

Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Enterobacteria phage H19B (Bacteriophage H19B) . Target Name: Shiga-like toxin 1 subunit B (stxB) . Accession Number: P69179; stxB. Expression Region: 21-89aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 11.7kda. Target Synonyms: Verocytotoxin 1 subunit B Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB) is a purified Recombinant Protein.

Accession Number

P69179; stxB

Expression Region

21-89aa

Host

E. coli

Target

Shiga-like toxin 1 subunit B (stxB)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

11.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Verocytotoxin 1 subunit B

Species

Enterobacteria phage H19B (Bacteriophage H19B)

Protein Name

Recombinant Protein

AA Sequence

TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ARL8C Polyclonal Antibody
MBS7145776 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ARL8C Polyclonal Antibody

Sign In for Pricing
View Details
HAUS1 3'UTR Luciferase Stable Cell Line
TU009565 1.0 mL

HAUS1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human anti-Cryptococcus neoformans glucuronoxylomannan (GXM) mAb (B8)
A09F13-B8 1 Each

Human anti-Cryptococcus neoformans glucuronoxylomannan (GXM) mAb (B8)

Sign In for Pricing
View Details
Rat Collagen Type XXVI Alpha 1 (COL26A1) ELISA Kit
MBS9926188-01 48 Well

Rat Collagen Type XXVI Alpha 1 (COL26A1) ELISA Kit

Sign In for Pricing
View Details
Rat Collagen Type XXVI Alpha 1 (COL26A1) ELISA Kit
MBS9926188-02 96 Well

Rat Collagen Type XXVI Alpha 1 (COL26A1) ELISA Kit

Sign In for Pricing
View Details
Rat Collagen Type XXVI Alpha 1 (COL26A1) ELISA Kit
MBS9926188-03 5x 96 Well

Rat Collagen Type XXVI Alpha 1 (COL26A1) ELISA Kit

Sign In for Pricing
View Details