Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB)

Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Enterobacteria phage H19B (Bacteriophage H19B) . Target Name: Shiga-like toxin 1 subunit B (stxB) . Accession Number: P69179; stxB. Expression Region: 21-89aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 11.7kda. Target Synonyms: Verocytotoxin 1 subunit B Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB) is a purified Recombinant Protein.

Accession Number

P69179; stxB

Expression Region

21-89aa

Host

E. coli

Target

Shiga-like toxin 1 subunit B (stxB)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

11.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Verocytotoxin 1 subunit B

Species

Enterobacteria phage H19B (Bacteriophage H19B)

Protein Name

Recombinant Protein

AA Sequence

TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTND2P2 sgRNA CRISPR Lentivector set (Human)
K1363801 3x 1.0 µg

MTND2P2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
SPG7 (NM_199367) Human Tagged ORF Clone
RG223633 10 µg

SPG7 (NM_199367) Human Tagged ORF Clone

Sign In for Pricing
View Details
Swine 8-Hydroxydeoxyguanosine (8-OHdG) ELISA Kit-Competitive
EK2F181 96 Tests

Swine 8-Hydroxydeoxyguanosine (8-OHdG) ELISA Kit-Competitive

Sign In for Pricing
View Details
CD49d (VLA4a Chain, Very Late Antigen 4) discontinued
C2404-47B 250 µg

CD49d (VLA4a Chain, Very Late Antigen 4) discontinued

Sign In for Pricing
View Details
Monkey S Antigen ELISA Kit
MBS738357-01 48 Well

Monkey S Antigen ELISA Kit

Sign In for Pricing
View Details
Monkey S Antigen ELISA Kit
MBS738357-02 96 Well

Monkey S Antigen ELISA Kit

Sign In for Pricing
View Details