Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proto-oncogene c-Rel (REL), partial

Recombinant Human Proto-oncogene c-Rel (REL), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Proto-oncogene c-Rel (REL) . Accession Number: Q04864; REL. Expression Region: 3-616aa. Tag Info: N-terminal 6xHis-B2M-tagged. Theoretical MW: 82.5kda. Target Synonyms: Avian reticuloendotheliosis; C REL; C Rel protein; c Rel proto oncogene protein; Oncogene REL; Oncogene REL avian reticuloendotheliosis; Proto-oncogene c-Rel; REL; REL_HUMAN; v rel avian reticuloendotheliosis viral oncogene homolog; v rel reticuloendotheliosis viral oncogene homolog; V rel reticuloendotheliosis viral oncogene homolog (avian) Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Proto-oncogene c-Rel (REL), partial is a purified Recombinant Protein.

Accession Number

Q04864; REL

Expression Region

3-616aa

Host

E. coli

Target

Proto-oncogene c-Rel (REL)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-B2M-Tagged

Field of Research

Transcription

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

82.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Avian reticuloendotheliosis; C REL; C Rel protein; c Rel proto oncogene protein; Oncogene REL; Oncogene REL avian reticuloendotheliosis; Proto-oncogene c-Rel; REL; REL_HUMAN; v rel avian reticuloendotheliosis viral oncogene homolog; v rel reticuloendotheliosis viral oncogene homolog; V rel reticuloendotheliosis viral oncogene homolog (avian)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse 9330020H09Rik activation kit by CRISPRa
GA219129 1 Kit

Mouse 9330020H09Rik activation kit by CRISPRa

Sign In for Pricing
View Details
Orforglipron Impurity 48
RM-O493048-01 10 mg

Orforglipron Impurity 48

Sign In for Pricing
View Details
Orforglipron Impurity 48
RM-O493048-02 100 mg

Orforglipron Impurity 48

Sign In for Pricing
View Details
Orforglipron Impurity 48
RM-O493048-03 25 mg

Orforglipron Impurity 48

Sign In for Pricing
View Details
Orforglipron Impurity 48
RM-O493048-04 50 mg

Orforglipron Impurity 48

Sign In for Pricing
View Details
Mouse Monoclonal beta-3 Adrenergic R/ADRB3 Antibody (493324) [PerCP]
FAB9419C 0.1 mL

Mouse Monoclonal beta-3 Adrenergic R/ADRB3 Antibody (493324) [PerCP]

Sign In for Pricing
View Details