Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Fibroblast growth factor 2 (FGF2)

Recombinant Chicken Fibroblast growth factor 2 (FGF2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Chicken (Gallus) . Target Name: Fibroblast growth factor 2 (FGF2) . Accession Number: P48800; FGF2. Expression Region: 13-158aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 18.3kda. Target Synonyms: FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Chicken Fibroblast growth factor 2 (FGF2) is a purified Recombinant Protein.

Accession Number

P48800; FGF2

Expression Region

13-158aa

Host

Yeast

Target

Fibroblast growth factor 2 (FGF2)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2

Species

Chicken (Gallus)

Protein Name

Recombinant Protein

AA Sequence

PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSGN1 Protein Vector (Rat) (pPM-C-HA)
PV283384 500 ng

MSGN1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Gnai2 (NM_031035) Rat Tagged ORF Clone Lentiviral Particle
RR214090L3V 200 µL

Gnai2 (NM_031035) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RAB38 (NM_022337) Human Tagged ORF Clone Lentiviral Particle
RC202196L4V 200 µL

RAB38 (NM_022337) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human Pregnane X Receptor (PXR) ELISA Kit
MBS2705314-01 24 Strip Well

Human Pregnane X Receptor (PXR) ELISA Kit

Sign In for Pricing
View Details
Human Pregnane X Receptor (PXR) ELISA Kit
MBS2705314-02 48 Strip Well

Human Pregnane X Receptor (PXR) ELISA Kit

Sign In for Pricing
View Details
Human Pregnane X Receptor (PXR) ELISA Kit
MBS2705314-03 96 Strip Well

Human Pregnane X Receptor (PXR) ELISA Kit

Sign In for Pricing
View Details