Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Low molecular weight antigen MTB12 (mtb12)

Recombinant Mycobacterium tuberculosis Low molecular weight antigen MTB12 (mtb12) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) . Target Name: Low molecular weight antigen MTB12 (mtb12) . Accession Number: P9WIN6; mtb12. Expression Region: 49-168aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 14.1kda. Target Synonyms: CFP-2 Low molecular weight protein antigen 2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mycobacterium tuberculosis Low molecular weight antigen MTB12 (mtb12) is a purified Recombinant Protein.

Accession Number

P9WIN6; mtb12

Expression Region

49-168aa

Host

Yeast

Target

Low molecular weight antigen MTB12 (mtb12)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

14.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CFP-2 Low molecular weight protein antigen 2

Species

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Protein Name

Recombinant Protein

AA Sequence

DPASAPDVPTAAQLTSLLNSLADPNVSFANKGSLVEGGIGGTEARIADHKLKKAAEHGDLPLSFSVTNIQPAAAGSATADVSVSGPKLSSPVTQNVTFVNQGGWMLSRASAMELLQAAGN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR4 mouse monoclonal antibody, clone 3B6, Purified
AM31767PU-N 50 µg

TLR4 mouse monoclonal antibody, clone 3B6, Purified

Sign In for Pricing
View Details
CD8 beta (Leu2 T lymphocyte antigen, MAL, OKT8 T Cell antigen, p32, T cell antigen Leu2, T cell surface glycoprotein CD8 beta, Suppressor/Cytotoxic T cell) (MaxLight 750) discontinued
C2259-99B-ML750 100 µL

CD8 beta (Leu2 T lymphocyte antigen, MAL, OKT8 T Cell antigen, p32, T cell antigen Leu2, T cell surface glycoprotein CD8 beta, Suppressor/Cytotoxic T cell) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Cadherin-16; CDH16 Protein (C-His, Human)
P513599 100 µg

Cadherin-16; CDH16 Protein (C-His, Human)

Sign In for Pricing
View Details
Sgpl1 Rat Pre-designed siRNA Set A
HY-RS28273 1 Set

Sgpl1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Motilin (MTL) Mouse ELISA Kit
F0954 96 Tests

Motilin (MTL) Mouse ELISA Kit

Sign In for Pricing
View Details
Human BCL9 shRNA Plasmid
abx950416-01 150 µg

Human BCL9 shRNA Plasmid

Sign In for Pricing
View Details