Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Low molecular weight antigen MTB12 (mtb12)

Recombinant Mycobacterium tuberculosis Low molecular weight antigen MTB12 (mtb12) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) . Target Name: Low molecular weight antigen MTB12 (mtb12) . Accession Number: P9WIN6; mtb12. Expression Region: 49-168aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 14.1kda. Target Synonyms: CFP-2 Low molecular weight protein antigen 2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mycobacterium tuberculosis Low molecular weight antigen MTB12 (mtb12) is a purified Recombinant Protein.

Accession Number

P9WIN6; mtb12

Expression Region

49-168aa

Host

Yeast

Target

Low molecular weight antigen MTB12 (mtb12)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

14.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CFP-2 Low molecular weight protein antigen 2

Species

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Protein Name

Recombinant Protein

AA Sequence

DPASAPDVPTAAQLTSLLNSLADPNVSFANKGSLVEGGIGGTEARIADHKLKKAAEHGDLPLSFSVTNIQPAAAGSATADVSVSGPKLSSPVTQNVTFVNQGGWMLSRASAMELLQAAGN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pak2 ORF Vector (Mouse) (pORF)
ORF053319 1.0 µg DNA

Pak2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
CLDN11 Antibody, HRP conjugated
A76871-100UL 100 µL

CLDN11 Antibody, HRP conjugated

Sign In for Pricing
View Details
ZNF862 Protein Lysate (Human) with C-Ha Tag
51895031 100 µg

ZNF862 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
ALDOB Mouse Monoclonal Antibody [Clone ID: LBI3E10]
AMM11281V 100 µL

ALDOB Mouse Monoclonal Antibody [Clone ID: LBI3E10]

Sign In for Pricing
View Details
SLC12A8 Adenovirus (Human)
43877052 1.0 mL

SLC12A8 Adenovirus (Human)

Sign In for Pricing
View Details
Recombinant Clostridium difficile Heat-inducible transcription repressor HrcA (hrcA)
MBS1443873-01 0.02 mg (E-Coli)

Recombinant Clostridium difficile Heat-inducible transcription repressor HrcA (hrcA)

Sign In for Pricing
View Details