Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Low molecular weight antigen MTB12 (mtb12)

Recombinant Mycobacterium tuberculosis Low molecular weight antigen MTB12 (mtb12) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) . Target Name: Low molecular weight antigen MTB12 (mtb12) . Accession Number: P9WIN6; mtb12. Expression Region: 49-168aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 14.1kda. Target Synonyms: CFP-2 Low molecular weight protein antigen 2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mycobacterium tuberculosis Low molecular weight antigen MTB12 (mtb12) is a purified Recombinant Protein.

Accession Number

P9WIN6; mtb12

Expression Region

49-168aa

Host

Yeast

Target

Low molecular weight antigen MTB12 (mtb12)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

14.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CFP-2 Low molecular weight protein antigen 2

Species

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Protein Name

Recombinant Protein

AA Sequence

DPASAPDVPTAAQLTSLLNSLADPNVSFANKGSLVEGGIGGTEARIADHKLKKAAEHGDLPLSFSVTNIQPAAAGSATADVSVSGPKLSSPVTQNVTFVNQGGWMLSRASAMELLQAAGN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr961 (NM_146504) Mouse Tagged ORF Clone Lentiviral Particle
MR212964L4V 200 µL

Olfr961 (NM_146504) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral human PLA2G2A sgRNA gene knockout kit - Lentiviral human PLA2G2A sgRNA gene knockout kit (100)
GTR15384139 1 Vial

Lentiviral human PLA2G2A sgRNA gene knockout kit - Lentiviral human PLA2G2A sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
SNX29 (RUNDC2A, RUN Domain Containing 2A, FLJ12363, OTTHUMP00000160262) (MaxLight 550)
MBS6215637-01 0.1 mL

SNX29 (RUNDC2A, RUN Domain Containing 2A, FLJ12363, OTTHUMP00000160262) (MaxLight 550)

Sign In for Pricing
View Details
SNX29 (RUNDC2A, RUN Domain Containing 2A, FLJ12363, OTTHUMP00000160262) (MaxLight 550)
MBS6215637-02 5x 0.1 mL

SNX29 (RUNDC2A, RUN Domain Containing 2A, FLJ12363, OTTHUMP00000160262) (MaxLight 550)

Sign In for Pricing
View Details
Cystatin C Mouse Monoclonal Antibody (3B12)
MBS8528808-01 0.1 mg

Cystatin C Mouse Monoclonal Antibody (3B12)

Sign In for Pricing
View Details
Cystatin C Mouse Monoclonal Antibody (3B12)
MBS8528808-02 0.1 mL (AF635)

Cystatin C Mouse Monoclonal Antibody (3B12)

Sign In for Pricing
View Details