Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Low molecular weight antigen MTB12 (mtb12)

Recombinant Mycobacterium tuberculosis Low molecular weight antigen MTB12 (mtb12) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) . Target Name: Low molecular weight antigen MTB12 (mtb12) . Accession Number: P9WIN6; mtb12. Expression Region: 49-168aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 14.1kda. Target Synonyms: CFP-2 Low molecular weight protein antigen 2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mycobacterium tuberculosis Low molecular weight antigen MTB12 (mtb12) is a purified Recombinant Protein.

Accession Number

P9WIN6; mtb12

Expression Region

49-168aa

Host

Yeast

Target

Low molecular weight antigen MTB12 (mtb12)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

14.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CFP-2 Low molecular weight protein antigen 2

Species

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Protein Name

Recombinant Protein

AA Sequence

DPASAPDVPTAAQLTSLLNSLADPNVSFANKGSLVEGGIGGTEARIADHKLKKAAEHGDLPLSFSVTNIQPAAAGSATADVSVSGPKLSSPVTQNVTFVNQGGWMLSRASAMELLQAAGN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR7027 Mouse MicroRNA Expression Plasmid (MI0022876)
SC402909 10 µg

MIR7027 Mouse MicroRNA Expression Plasmid (MI0022876)

Sign In for Pricing
View Details
Absolute Mag™ Carboxyl Magnetic Particles, 1.0-1.4 μm
WHM-S028 10 mL

Absolute Mag™ Carboxyl Magnetic Particles, 1.0-1.4 μm

Sign In for Pricing
View Details
M6PR Antibody
A38590-50UG 50 µg

M6PR Antibody

Sign In for Pricing
View Details
OR2A3P Protein Vector (Human) (pPM-C-His)
PV106409 500 ng

OR2A3P Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Bordetella Avium rpsO Protein (aa 1-89)
VAng-Lsx4111-1mgEcoli 1 mg (E. coli)

Recombinant Bordetella Avium rpsO Protein (aa 1-89)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III UPF0337 protein gbs0600 (gbs0600)
MBS1374224-01 0.02 mg (E-Coli)

Recombinant Streptococcus agalactiae serotype III UPF0337 protein gbs0600 (gbs0600)

Sign In for Pricing
View Details