Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lama glama Interleukin-2 (IL2)

Recombinant Lama glama Interleukin-2 (IL2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Lama glama (Llama) . Target Name: Interleukin-2 (IL2) . Accession Number: Q865X2; IL2. Expression Region: 21-154aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 19.6kda. Target Synonyms: IL-2; T-cell growth factor; TCGF Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Lama glama Interleukin-2 (IL2) is a purified Recombinant Protein.

Accession Number

Q865X2; IL2

Expression Region

21-154aa

Host

E. coli

Target

Interleukin-2 (IL2)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IL-2; T-cell growth factor; TCGF

Species

Lama glama (Llama)

Protein Name

Recombinant Protein

AA Sequence

APTLSSTKDTKKQLEPLLLDLQFLLKEVNNYENLKLSRMLTFKFYMPKKATELKHLQCLMEELKPLEEVLNLAQSKNSHLTNIKDSMNNINLTVSELKGSETGFTCEYDDETVTVVEFLNKWITFCQSIYSTMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta Catenin (CTNNB1) (NM_001904) Human Recombinant Protein
PH32648I1 20 µg

Beta Catenin (CTNNB1) (NM_001904) Human Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human ZNHIT2 sgRNA gene knockout kit - Lentiviral human ZNHIT2 sgRNA gene knockout kit (plasmid)
GTR15370316 1 Vial

Lentiviral human ZNHIT2 sgRNA gene knockout kit - Lentiviral human ZNHIT2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Von Willebrand Factor Antibody / vWF
V8821SAF-100UG 100 µg

Von Willebrand Factor Antibody / vWF

Sign In for Pricing
View Details
CHRM2 Blocking Peptide
orb706514-01 1 mg

CHRM2 Blocking Peptide

Sign In for Pricing
View Details
CHRM2 Blocking Peptide
orb706514-02 5 mg

CHRM2 Blocking Peptide

Sign In for Pricing
View Details
Mouse Anti-GAPDH Recombinant Antibody (clone 2B8-1)
ZG-0053C Each

Mouse Anti-GAPDH Recombinant Antibody (clone 2B8-1)

Sign In for Pricing
View Details