Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Chemotaxis inhibitory protein (chp)

Recombinant Staphylococcus aureus Chemotaxis inhibitory protein (chp) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain NCTC 8325 / PS 47) . Target Name: Chemotaxis inhibitory protein (chp) . Accession Number: Q2FWV5; chp. Expression Region: 29-149aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 21.5kda. Target Synonyms: CHIPS Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Staphylococcus aureus Chemotaxis inhibitory protein (chp) is a purified Recombinant Protein.

Accession Number

Q2FWV5; chp

Expression Region

29-149aa

Host

E. coli

Target

Chemotaxis inhibitory protein (chp)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CHIPS

Species

Staphylococcus aureus (strain NCTC 8325 / PS 47)

Protein Name

Recombinant Protein

AA Sequence

FTFEPFPTNEEIESNKKLLEKEKAYKESFKNSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RV G Rabbit pAb, IRDye 800CW conjugated
orb2888442 100 µL

RV G Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Lentiviral mouse Bsph1 shRNA (UAS) - Lentiviral mouse Bsph1 shRNA (UAS, RFP) (100)
GTR15304623 1 Vial

Lentiviral mouse Bsph1 shRNA (UAS) - Lentiviral mouse Bsph1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Hsa-miR-4313 miRNA Inhibitor
orb1872481-01 10 nmol

Hsa-miR-4313 miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-4313 miRNA Inhibitor
orb1872481-02 20 nmol

Hsa-miR-4313 miRNA Inhibitor

Sign In for Pricing
View Details
Anti-Kv1.1 potassium (Recombinant Rabbit, Monoclonal, IgG)
A115573 100 µL

Anti-Kv1.1 potassium (Recombinant Rabbit, Monoclonal, IgG)

Sign In for Pricing
View Details
Cyp3a41b CRISPR Activation Plasmid (m)
sc-437214-ACT 20 µg

Cyp3a41b CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details