Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Cytosol aminopeptidase (LAP3), partial

Recombinant Bovine Cytosol aminopeptidase (LAP3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus) . Target Name: Cytosol aminopeptidase (LAP3) . Accession Number: P00727; LAP3. Expression Region: 25-64aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 20.3kda. Target Synonyms: Leucine aminopeptidase 3; LAP-3Leucyl aminopeptidasePeptidase SProline aminopeptidase (EC:3.4.11.5) Prolyl aminopeptidase Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Bovine Cytosol aminopeptidase (LAP3), partial is a purified Recombinant Protein.

Accession Number

P00727; LAP3

Expression Region

25-64aa

Host

E. coli

Target

Cytosol aminopeptidase (LAP3)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Leucine aminopeptidase 3; LAP-3Leucyl aminopeptidasePeptidase SProline aminopeptidase (EC:3.4.11.5) Prolyl aminopeptidase

Species

Bovine (Bos taurus)

Protein Name

Recombinant Protein

AA Sequence

PGPAAADMTKGLVLGIYSKEKEEDEPQFTSAGENFNKLVS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGB4 (High Mobility Group Protein B4, dJ1007G16.5) (MaxLight 405)
MBS6421056-01 0.1 mL

HMGB4 (High Mobility Group Protein B4, dJ1007G16.5) (MaxLight 405)

Sign In for Pricing
View Details
HMGB4 (High Mobility Group Protein B4, dJ1007G16.5) (MaxLight 405)
MBS6421056-02 5x 0.1 mL

HMGB4 (High Mobility Group Protein B4, dJ1007G16.5) (MaxLight 405)

Sign In for Pricing
View Details
Human IL4I1 (Interleukin 4 Induced Protein 1) ELISA Kit
RE2348H-01 48 Tests

Human IL4I1 (Interleukin 4 Induced Protein 1) ELISA Kit

Sign In for Pricing
View Details
Human IL4I1 (Interleukin 4 Induced Protein 1) ELISA Kit
RE2348H-02 96 Tests

Human IL4I1 (Interleukin 4 Induced Protein 1) ELISA Kit

Sign In for Pricing
View Details
Human PLA2R1 full length protein-synthetic nanodisc
MBS189903-01 0.01 mg

Human PLA2R1 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human PLA2R1 full length protein-synthetic nanodisc
MBS189903-02 0.05 mg

Human PLA2R1 full length protein-synthetic nanodisc

Sign In for Pricing
View Details